SimulationCraft 902-01

for World of Warcraft 9.0.2.36599 Live (wow build level 36599)

Beta Release

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-10-25 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00
2020-09-20 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

Kyrian_Forgelite : 9302 dps, 5040 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9302.3 9302.3 16.0 / 0.172% 740.3 / 8.0% 19.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
407.8 404.9 Mana 0.00% 38.4 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_Forgelite 9302
Cataclysm 780 8.4% 9.7 32.42sec 24058 14159 Direct 29.1 6705 13418 8016 19.6%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.69 29.06 0.00 0.00 1.6992 0.0000 233075.03 233075.03 0.00% 14159.23 14159.23
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.43% 23.38 14 33 6705.34 6142 7261 6705.43 6472 6947 156776 156776 0.00%
crit 19.57% 5.69 0 12 13418.41 12283 14521 13374.25 0 14476 76299 76299 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.75
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (999) 0.0% (10.8%) 11.9 25.79sec 25062 9264

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.91 0.00 177.80 0.00 2.7053 0.1643 0.00 0.00 0.00% 9264.28 9264.28

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:11.93
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 999 10.8% 0.0 0.00sec 0 0 Direct 533.4 469 936 560 19.4%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 533.40 0.00 0.00 0.0000 0.0000 298578.41 298578.41 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.59% 429.88 312 564 468.96 263 976 469.17 442 497 201613 201613 0.00%
crit 19.41% 103.52 66 145 936.50 525 1952 936.87 811 1091 96966 96966 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1130 (1502) 12.1% (16.1%) 18.8 15.97sec 23862 12019 Direct 37.3 (73.7) 0 9032 9032 100.0% (60.2%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.78 37.32 0.00 0.00 1.9853 0.0000 337152.63 337152.63 0.00% 12019.37 12019.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 37.32 26 50 9032.43 5871 12241 9032.69 8765 9265 337153 337153 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [R]:18.87
  • if_expr:cast_time<havoc_remains
    Internal Combustion 372 4.0% 36.3 15.96sec 3055 0 Direct 36.3 2559 5136 3056 19.2%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.33 36.33 0.00 0.00 0.0000 0.0000 110989.43 110989.43 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 29.34 18 41 2559.39 1 3715 2562.41 2244 2815 75108 75108 0.00%
crit 19.23% 6.99 1 16 5136.14 2 7428 5146.06 3122 6546 35881 35881 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 789 8.5% 36.7 7.96sec 6414 5134 Direct 54.7 3621 7240 4309 19.0%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.74 54.69 0.00 0.00 1.2493 0.0000 235673.66 235673.66 0.00% 5133.94 5133.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.01% 44.31 31 60 3621.32 2047 5042 3621.57 3395 3847 160434 160434 0.00%
crit 18.99% 10.39 2 21 7239.98 4095 10084 7248.60 5111 9153 75239 75239 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.78
  • if_expr:buff.backdraft.down
    havoc
    [N]:17.95
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1589 17.1% 25.3 11.63sec 18808 14939 Direct 31.5 1517 3029 1808 19.3%
Periodic 345.8 1015 2030 1209 19.1% 95.7%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.25 31.51 345.80 345.80 1.2590 2.4829 474979.81 474979.81 0.00% 533.45 14939.29
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 25.44 16 36 1516.70 819 2017 1517.14 1394 1639 38577 38577 0.00%
crit 19.26% 6.07 0 14 3028.75 1640 4032 3020.83 0 3715 18378 18378 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.90% 279.76 210 346 1015.11 0 1261 1015.27 992 1044 283998 283998 0.00%
crit 19.10% 66.03 33 99 2030.03 7 2521 2030.16 1939 2147 134027 134027 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:17.55
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [Q]:7.83
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 555 6.0% 39.3 6.98sec 4223 2996 Direct 50.0 (50.0) 2782 5558 3320 19.4% (19.4%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.32 50.00 0.00 0.00 1.4093 0.0000 166047.86 166047.86 0.00% 2996.50 2996.50
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 40.31 23 61 2781.74 1313 3426 2784.31 2605 3026 112133 112133 0.00%
crit 19.39% 9.70 2 19 5557.50 2670 6852 5566.43 4212 6598 53915 53915 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:28.46
    havoc
    [S]:11.06
  • if_expr:cast_time<havoc_remains
Rain of Fire 966 10.4% 18.4 15.48sec 15685 12636 Periodic 437.3 553 1106 660 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.40 0.00 0.00 437.32 1.2412 0.0000 288522.17 288522.17 0.00% 12636.19 12636.19
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.66% 352.76 226 483 552.84 507 599 552.82 546 560 195007 195007 0.00%
crit 19.34% 84.56 47 120 1105.98 1013 1198 1105.92 1086 1127 93516 93516 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:6.45
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.95
Scouring Tithe 331 3.6% 13.4 22.61sec 7400 4403 Direct 18.7 1482 2966 1775 19.8%
Periodic 133.2 413 826 493 19.3% 36.5%

Stats Details: Scouring Tithe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.37 18.75 133.16 133.16 1.6807 2.4563 98945.48 98945.48 0.00% 283.05 4403.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.20% 15.03 8 22 1481.91 1004 1674 1482.32 1339 1618 22274 22274 0.00%
crit 19.80% 3.71 0 10 2966.14 2009 3348 2936.96 0 3348 11016 11016 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.67% 107.42 71 144 413.15 123 419 413.13 410 416 44379 44379 0.00%
crit 19.33% 25.75 11 42 826.29 246 837 826.32 795 837 21276 21276 0.00%

Action Details: Scouring Tithe

  • id:312321
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.150000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:312321
  • name:Scouring Tithe
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Deal {$s1=0 + 60.0%} Arcane damage instantly, and $o2 over {$d=18 seconds}. If the enemy dies while affected by Scouring Tithe, you generate $?a137043[${{$s3=50}/10}]?a137044[${{$s4=50}/10}][${{$s5=50}/10}] Soul $LShard:Shards;. If they survive, Scouring Tithe's cooldown is refreshed.

Action Priority List

    aoe
    [K]:6.68
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    havoc
    [P]:6.76
Soul Fire 476 5.1% 5.5 49.46sec 25780 7414 Direct 7.3 16234 32525 19386 19.4%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.52 7.34 0.00 0.00 3.4775 0.0000 142390.49 142390.49 0.00% 7413.85 7413.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 5.92 2 9 16234.08 8602 21173 16250.46 11812 19707 96045 96045 0.00%
crit 19.39% 1.42 0 5 32524.97 17211 42310 25214.15 0 42310 46346 46346 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.72
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:0.90
  • if_expr:cast_time<havoc_remains
Summon Infernal 82 0.9% 2.0 180.56sec 12016 10394 Direct 6.0 3348 6696 4001 19.6%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24031.57 24031.57 0.00% 10394.28 10394.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.37% 4.82 1 6 3348.13 3348 3348 3348.13 3348 3348 16146 16146 0.00%
crit 19.63% 1.18 0 5 6696.27 6696 6696 4917.74 0 6696 7886 7886 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3512 / 714
Immolation 3247 7.0% 39.0 5.49sec 4995 0 Direct 117.0 1395 2790 1665 19.4%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194805.65 194805.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 94.36 82 107 1395.06 1395 1395 1395.06 1395 1395 131638 131638 0.00%
crit 19.35% 22.64 10 35 2790.11 2790 2790 2790.11 2790 2790 63168 63168 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.6% 41.0 5.25sec 388 270 Direct 41.0 326 651 388 19.2%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15904.66 22718.21 29.99% 270.01 270.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.84% 33.15 25 40 325.55 326 326 325.55 326 326 10791 15413 29.99%
crit 19.16% 7.85 1 16 651.10 651 651 651.10 651 651 5114 7305 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 513 / 513
Firebolt 513 5.5% 93.0 3.22sec 1649 1133 Direct 92.3 1395 2790 1661 19.1%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.02 92.30 0.00 0.00 1.4558 0.0000 153375.83 153375.83 0.00% 1132.58 1132.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.89% 74.66 55 97 1395.06 1395 1395 1395.06 1395 1395 104154 104154 0.00%
crit 19.11% 17.64 7 32 2790.11 2790 2790 2790.11 2790 2790 49222 49222 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.47
pet - bron 61 / 6
melee 61 0.1% 9.0 2.88sec 205 157 Direct 9.0 172 343 205 19.3%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.3020 0.0000 1844.20 2634.26 29.99% 157.38 157.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 7.26 3 9 171.70 172 172 171.70 172 172 1246 1780 29.99%
crit 19.34% 1.74 0 6 343.40 343 343 293.95 0 343 598 854 25.67%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
Kyrian_Forgelite
Havoc 9.6 32.29sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.64 0.00 0.00 0.00 1.2443 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.64
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.
pet - bron
Anima Cannon 4.0 8.00sec

Stats Details: Anima Cannon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Anima Cannon

  • id:332525
  • school:arcane
  • range:100.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:8.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:332525
  • name:Anima Cannon
  • school:arcane
  • tooltip:
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}

Action Priority List

    default
    [ ]:4.00
Vitalizing Bolt (goliath_support) 7.0 4.00sec

Stats Details: Goliath Support

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 7.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Goliath Support

  • id:332526
  • school:arcane
  • range:100.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:4.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite_bron
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:332526
  • name:Vitalizing Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}

Action Priority List

    default
    [ ]:7.00
Smash 3.0 8.17sec

Stats Details: Smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 2.1710 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Smash

  • id:341163
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:3.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:341163
  • name:Smash
  • school:physical
  • tooltip:
  • description:Attacks the ground with a heavy smash, inflicting Arcane damage to all enemies in a cone in front of the caster.

Action Priority List

    default
    [ ]:4.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.7 0.0 8.0sec 8.0sec 4.5sec 54.66% 0.00% 0.0 (0.0) 3.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 23.7s
  • trigger_min/max:1.9s / 23.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:54.66%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.56% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.56%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bron's Call to Action 2.0 135.1 189.9sec 2.2sec 148.5sec 99.28% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_brons_call_to_action
  • max_stacks:89
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:177.7s / 204.2s
  • trigger_min/max:0.0s / 8.0s
  • trigger_pct:100.00%
  • duration_min/max:41.8s / 201.4s

Stack Uptimes

  • brons_call_to_action_1:1.37%
  • brons_call_to_action_2:1.62%
  • brons_call_to_action_3:1.22%
  • brons_call_to_action_4:1.69%
  • brons_call_to_action_5:1.59%
  • brons_call_to_action_6:1.73%
  • brons_call_to_action_7:1.53%
  • brons_call_to_action_8:1.28%
  • brons_call_to_action_9:1.11%
  • brons_call_to_action_10:1.44%
  • brons_call_to_action_11:0.92%
  • brons_call_to_action_12:1.60%
  • brons_call_to_action_13:1.41%
  • brons_call_to_action_14:1.02%
  • brons_call_to_action_15:1.34%
  • brons_call_to_action_16:1.28%
  • brons_call_to_action_17:1.23%
  • brons_call_to_action_18:1.39%
  • brons_call_to_action_19:1.49%
  • brons_call_to_action_20:1.38%
  • brons_call_to_action_21:1.33%
  • brons_call_to_action_22:1.34%
  • brons_call_to_action_23:1.38%
  • brons_call_to_action_24:1.40%
  • brons_call_to_action_25:1.50%
  • brons_call_to_action_26:1.56%
  • brons_call_to_action_27:1.58%
  • brons_call_to_action_28:1.59%
  • brons_call_to_action_29:1.50%
  • brons_call_to_action_30:1.47%
  • brons_call_to_action_31:1.35%
  • brons_call_to_action_32:1.33%
  • brons_call_to_action_33:1.35%
  • brons_call_to_action_34:1.30%
  • brons_call_to_action_35:1.33%
  • brons_call_to_action_36:1.26%
  • brons_call_to_action_37:1.19%
  • brons_call_to_action_38:1.16%
  • brons_call_to_action_39:1.09%
  • brons_call_to_action_40:1.21%
  • brons_call_to_action_41:1.19%
  • brons_call_to_action_42:1.05%
  • brons_call_to_action_43:1.05%
  • brons_call_to_action_44:1.12%
  • brons_call_to_action_45:1.11%
  • brons_call_to_action_46:1.05%
  • brons_call_to_action_47:1.14%
  • brons_call_to_action_48:1.13%
  • brons_call_to_action_49:1.11%
  • brons_call_to_action_50:1.18%
  • brons_call_to_action_51:1.15%
  • brons_call_to_action_52:1.18%
  • brons_call_to_action_53:1.16%
  • brons_call_to_action_54:1.11%
  • brons_call_to_action_55:1.09%
  • brons_call_to_action_56:1.03%
  • brons_call_to_action_57:0.90%
  • brons_call_to_action_58:0.83%
  • brons_call_to_action_59:0.83%
  • brons_call_to_action_60:0.89%
  • brons_call_to_action_61:0.88%
  • brons_call_to_action_62:0.86%
  • brons_call_to_action_63:0.86%
  • brons_call_to_action_64:0.85%
  • brons_call_to_action_65:0.87%
  • brons_call_to_action_66:0.85%
  • brons_call_to_action_67:0.85%
  • brons_call_to_action_68:0.85%
  • brons_call_to_action_69:0.89%
  • brons_call_to_action_70:0.97%
  • brons_call_to_action_71:1.02%
  • brons_call_to_action_72:0.96%
  • brons_call_to_action_73:0.89%
  • brons_call_to_action_74:0.77%
  • brons_call_to_action_75:0.71%
  • brons_call_to_action_76:0.68%
  • brons_call_to_action_77:0.71%
  • brons_call_to_action_78:0.70%
  • brons_call_to_action_79:0.73%
  • brons_call_to_action_80:0.74%
  • brons_call_to_action_81:0.76%
  • brons_call_to_action_82:0.74%
  • brons_call_to_action_83:0.76%
  • brons_call_to_action_84:0.76%
  • brons_call_to_action_85:0.74%
  • brons_call_to_action_86:0.72%
  • brons_call_to_action_87:0.69%
  • brons_call_to_action_88:0.67%
  • brons_call_to_action_89:0.65%

Spelldata

  • id:332514
  • name:Bron's Call to Action
  • tooltip:Bron arrives in ${{$332514u=89}+1-$w1} damaging or healing spells or abilities.
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}
  • max_stacks:89
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
infernal - infernal: Embers 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 186.4s
  • trigger_min/max:180.0s / 186.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 186.4s
  • trigger_min/max:180.0s / 186.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 10.89% 7.86% 14.12% 0.7s 0.0s 6.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_Forgelite
soul_fire Soul Shard 6.54 6.91 7.34% 1.06 0.51 6.87%
immolate Soul Shard 345.78 33.31 35.40% 0.10 1.27 3.67%
incinerate Soul Shard 39.33 10.04 10.67% 0.26 0.03 0.29%
conflagrate Soul Shard 36.73 27.34 29.05% 0.74 0.00 0.00%
mana_regen Mana 658.70 121107.26 100.00% 183.86 28141.20 18.86%
immolate_crits Soul Shard 33.06 3.19 3.39% 0.10 0.12 3.49%
incinerate_crits Soul Shard 9.70 0.97 1.03% 0.10 0.00 0.16%
infernal Soul Shard 120.00 10.28 10.93% 0.09 1.72 14.31%
souring_tithe Soul Shard 1.00 2.06 2.19% 2.07 2.92 58.61%
pet - imp
energy_regen Energy 360.01 3550.34 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 404.90 407.79 28147.9 49133.8 47516.5 50000.0
Soul Shard 4.0 0.31 0.31 6.6 4.4 0.1 5.0
Usage Type Count Total Avg RPE APR
Kyrian_Forgelite
cataclysm Mana 9.7 4847.9 500.0 500.4 48.1
channel_demonfire Mana 11.9 8943.8 750.0 750.7 33.4
chaos_bolt Soul Shard 18.8 37.5 2.0 2.0 11944.2
conflagrate Mana 36.7 18366.6 500.0 499.9 12.8
havoc Mana 9.6 9638.1 1000.0 999.5 0.0
immolate Mana 25.3 18940.7 750.0 750.0 25.1
incinerate Mana 39.3 39333.9 1000.0 1000.3 4.2
rain_of_fire Soul Shard 18.4 55.2 3.0 3.0 5226.6
scouring_tithe Mana 13.4 13365.1 1000.0 999.5 7.4
soul_fire Mana 6.5 6535.1 1000.0 1183.2 21.8
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 93.0 3720.9 40.0 40.0 41.2

Statistics & Data Analysis

Fight Length
Kyrian_Forgelite Fight Length
Count 625
Mean 299.05
Minimum 240.24
Maximum 359.94
Spread ( max - min ) 119.70
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Kyrian_Forgelite Damage Per Second
Count 625
Mean 9302.26
Minimum 8743.80
Maximum 9885.60
Spread ( max - min ) 1141.80
Range [ ( max - min ) / 2 * 100% ] 6.14%
Standard Deviation 203.6919
5th Percentile 9000.64
95th Percentile 9660.40
( 95th Percentile - 5th Percentile ) 659.75
Mean Distribution
Standard Deviation 8.1477
95.00% Confidence Interval ( 9286.30 - 9318.23 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1842
0.1 Scale Factor Error with Delta=300 355
0.05 Scale Factor Error with Delta=300 1417
0.01 Scale Factor Error with Delta=300 35419
Priority Target DPS
Kyrian_Forgelite Priority Target Damage Per Second
Count 625
Mean 5039.54
Minimum 4740.27
Maximum 5448.33
Spread ( max - min ) 708.05
Range [ ( max - min ) / 2 * 100% ] 7.02%
Standard Deviation 121.2114
5th Percentile 4847.67
95th Percentile 5245.93
( 95th Percentile - 5th Percentile ) 398.26
Mean Distribution
Standard Deviation 4.8485
95.00% Confidence Interval ( 5030.04 - 5049.04 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2223
0.1 Scale Factor Error with Delta=300 126
0.05 Scale Factor Error with Delta=300 502
0.01 Scale Factor Error with Delta=300 12543
DPS(e)
Kyrian_Forgelite Damage Per Second (Effective)
Count 625
Mean 9302.26
Minimum 8743.80
Maximum 9885.60
Spread ( max - min ) 1141.80
Range [ ( max - min ) / 2 * 100% ] 6.14%
Damage
Kyrian_Forgelite Damage
Count 625
Mean 2410386.53
Minimum 1914162.49
Maximum 2936725.56
Spread ( max - min ) 1022563.07
Range [ ( max - min ) / 2 * 100% ] 21.21%
DTPS
Kyrian_Forgelite Damage Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_Forgelite Healing Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_Forgelite Healing Per Second (Effective)
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_Forgelite Heal
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_Forgelite Healing Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_Forgelite Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_ForgeliteTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_Forgelite Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.72 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.75 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 6.45 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 11.93 channel_demonfire,if=dot.immolate.remains>cast_time
F 17.55 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.64 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.95 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.78 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
K 6.68 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 28.46 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 17.95 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 0.90 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
P 6.76 scouring_tithe
Q 7.83 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
R 18.87 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
S 11.06 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHPRNRNQRNDFEDLFFJKDLJLJADLEHNRSRONFFIKELJILAJLHRSSNPQEIFLJLJLIL9AHNPRNRSQEFJIFLJKLLILAHNRSSNQP9EFIJLIJLLLAHNPRRSNQEFLFMDJKLD9AHNRNRRNPDFEFFJLILJLLAHPNRSRQN9EFIJKLLIJAHSSRSNQPEILJFLJLLIL9AEHNPRNRQNILLFLEF

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.740 aoe E channel_demonfire Fluffy_Pillow 49370.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:04.134 cds M summon_infernal Fluffy_Pillow 49817.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust
0:05.140 aoe H havoc enemy2 49320.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust
0:06.146 havoc P scouring_tithe Fluffy_Pillow 48823.0/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust
0:07.487 havoc R chaos_bolt Fluffy_Pillow 48493.5/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:09.496 havoc N conflagrate Fluffy_Pillow 49498.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust
0:10.502 havoc R chaos_bolt Fluffy_Pillow 49501.0/50000: 99% mana
4.6/5: 92% soul_shard
bloodlust, backdraft
0:11.908 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:12.914 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:13.921 havoc R chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.7/5: 94% soul_shard
bloodlust, backdraft
0:15.329 havoc N conflagrate Fluffy_Pillow 49956.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:16.336 aoe D rain_of_fire Fluffy_Pillow 49960.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:17.342 aoe F immolate enemy3 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
bloodlust, backdraft
0:18.348 aoe E channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
2.2/5: 44% soul_shard
bloodlust, backdraft
0:20.764 aoe D rain_of_fire Fluffy_Pillow 49710.0/50000: 99% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:21.770 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
bloodlust, backdraft
0:22.709 aoe F immolate enemy2 49002.0/50000: 98% mana
1.0/5: 20% soul_shard
bloodlust
0:23.713 aoe F immolate Fluffy_Pillow 48754.0/50000: 98% mana
1.3/5: 26% soul_shard
bloodlust
0:24.721 aoe J conflagrate Fluffy_Pillow 48508.0/50000: 97% mana
1.8/5: 36% soul_shard
bloodlust
0:25.729 aoe K scouring_tithe Fluffy_Pillow 48512.0/50000: 97% mana
2.7/5: 54% soul_shard
bloodlust, backdraft
0:27.068 aoe D rain_of_fire Fluffy_Pillow 48181.5/50000: 96% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:28.075 aoe L incinerate Fluffy_Pillow 48685.0/50000: 97% mana
0.6/5: 12% soul_shard
bloodlust, backdraft
0:29.014 aoe J conflagrate Fluffy_Pillow 48154.5/50000: 96% mana
1.0/5: 20% soul_shard
bloodlust
0:30.021 aoe L incinerate Fluffy_Pillow 48158.0/50000: 96% mana
2.0/5: 40% soul_shard
bloodlust, backdraft
0:30.960 aoe J conflagrate Fluffy_Pillow 47627.5/50000: 95% mana
2.4/5: 48% soul_shard
bloodlust
0:31.966 default A cataclysm Fluffy_Pillow 47630.5/50000: 95% mana
3.4/5: 68% soul_shard
bloodlust, backdraft
0:33.308 aoe D rain_of_fire Fluffy_Pillow 47801.5/50000: 96% mana
3.7/5: 74% soul_shard
bloodlust, backdraft
0:34.315 aoe L incinerate Fluffy_Pillow 48305.0/50000: 97% mana
1.2/5: 24% soul_shard
bloodlust, backdraft
0:35.254 aoe E channel_demonfire Fluffy_Pillow 47774.5/50000: 96% mana
1.4/5: 28% soul_shard
bloodlust
0:37.395 aoe H havoc enemy2 48095.0/50000: 96% mana
1.8/5: 36% soul_shard
bloodlust
0:38.401 havoc N conflagrate Fluffy_Pillow 47598.0/50000: 95% mana
2.3/5: 46% soul_shard
bloodlust
0:39.407 havoc R chaos_bolt Fluffy_Pillow 47601.0/50000: 95% mana
3.3/5: 66% soul_shard
bloodlust, backdraft
0:40.815 havoc S incinerate Fluffy_Pillow 48305.0/50000: 97% mana
1.7/5: 34% soul_shard
bloodlust
0:42.157 havoc R chaos_bolt Fluffy_Pillow 47976.0/50000: 96% mana
2.4/5: 48% soul_shard
0:44.768 havoc O soul_fire Fluffy_Pillow 49281.5/50000: 99% mana
0.9/5: 18% soul_shard
0:48.478 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
3.0/5: 60% soul_shard
0:49.783 aoe F immolate Fluffy_Pillow 49155.0/50000: 98% mana
4.1/5: 82% soul_shard
backdraft
0:51.090 aoe F immolate enemy3 49058.5/50000: 98% mana
4.1/5: 82% soul_shard
backdraft
0:52.396 aoe I rain_of_fire Fluffy_Pillow 48961.5/50000: 98% mana
4.2/5: 84% soul_shard
backdraft
0:53.702 aoe K scouring_tithe Fluffy_Pillow 49614.5/50000: 99% mana
1.4/5: 28% soul_shard
backdraft
0:55.442 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
1.8/5: 36% soul_shard
backdraft
0:58.288 aoe L incinerate Fluffy_Pillow 49675.0/50000: 99% mana
2.1/5: 42% soul_shard
backdraft
0:59.506 aoe J conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
2.3/5: 46% soul_shard
1:00.812 aoe I rain_of_fire Fluffy_Pillow 49154.5/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
1:02.117 aoe L incinerate Fluffy_Pillow 49807.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft
1:03.337 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
0.7/5: 14% soul_shard
1:05.078 aoe J conflagrate Fluffy_Pillow 49373.0/50000: 99% mana
0.7/5: 14% soul_shard
1:06.386 aoe L incinerate Fluffy_Pillow 49527.0/50000: 99% mana
1.5/5: 30% soul_shard
backdraft
1:07.604 aoe H havoc enemy2 49001.5/50000: 98% mana
1.7/5: 34% soul_shard
1:08.911 havoc R chaos_bolt Fluffy_Pillow 48655.0/50000: 97% mana
2.0/5: 40% soul_shard
1:11.519 havoc S incinerate Fluffy_Pillow 49959.0/50000: 100% mana
0.3/5: 6% soul_shard
1:13.259 havoc S incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.8/5: 16% soul_shard
1:14.998 havoc N conflagrate Fluffy_Pillow 48871.5/50000: 98% mana
1.4/5: 28% soul_shard
1:16.304 havoc P scouring_tithe Fluffy_Pillow 49024.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
1:18.045 havoc Q immolate Fluffy_Pillow 48895.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
1:19.353 aoe E channel_demonfire Fluffy_Pillow 48799.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
1:22.173 aoe I rain_of_fire Fluffy_Pillow 49459.0/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
1:23.481 aoe F immolate enemy3 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
backdraft
1:24.788 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.8/5: 16% soul_shard
backdraft
1:26.010 aoe J conflagrate Fluffy_Pillow 48863.5/50000: 98% mana
1.0/5: 20% soul_shard
1:27.316 aoe L incinerate Fluffy_Pillow 49016.5/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
1:28.536 aoe J conflagrate Fluffy_Pillow 48626.5/50000: 97% mana
2.1/5: 42% soul_shard
1:29.843 aoe L incinerate Fluffy_Pillow 48780.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
1:31.062 aoe I rain_of_fire Fluffy_Pillow 48389.5/50000: 97% mana
3.1/5: 62% soul_shard
1:32.368 aoe L incinerate Fluffy_Pillow 49042.5/50000: 98% mana
0.4/5: 8% soul_shard
1:34.109 default 9 soul_fire Fluffy_Pillow 48913.0/50000: 98% mana
0.7/5: 14% soul_shard
1:37.586 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
2.2/5: 44% soul_shard
1:39.328 aoe H havoc enemy2 49373.0/50000: 99% mana
2.4/5: 48% soul_shard
1:40.633 havoc N conflagrate Fluffy_Pillow 49025.5/50000: 98% mana
2.6/5: 52% soul_shard
1:41.940 havoc P scouring_tithe Fluffy_Pillow 49179.0/50000: 98% mana
3.8/5: 76% soul_shard
backdraft
1:43.680 havoc R chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
3.9/5: 78% soul_shard
backdraft
1:45.508 havoc N conflagrate Fluffy_Pillow 49916.0/50000: 100% mana
2.2/5: 44% soul_shard
1:46.815 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.2/5: 64% soul_shard
backdraft
1:48.642 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
1:50.381 havoc Q immolate Fluffy_Pillow 49001.5/50000: 98% mana
2.4/5: 48% soul_shard
1:51.689 aoe E channel_demonfire Fluffy_Pillow 48905.5/50000: 98% mana
2.4/5: 48% soul_shard
1:54.620 aoe F immolate enemy2 49621.0/50000: 99% mana
2.7/5: 54% soul_shard
1:55.928 aoe J conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
2.9/5: 58% soul_shard
1:57.234 aoe I rain_of_fire Fluffy_Pillow 49406.0/50000: 99% mana
3.4/5: 68% soul_shard
backdraft
1:58.540 aoe F immolate enemy3 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
backdraft
1:59.845 aoe L incinerate Fluffy_Pillow 49251.5/50000: 99% mana
0.8/5: 16% soul_shard
backdraft
2:01.067 aoe J conflagrate Fluffy_Pillow 48862.5/50000: 98% mana
1.2/5: 24% soul_shard
2:02.438 aoe K scouring_tithe Fluffy_Pillow 49048.0/50000: 98% mana
1.8/5: 36% soul_shard
backdraft
2:04.180 aoe L incinerate Fluffy_Pillow 48919.0/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
2:05.400 aoe L incinerate Fluffy_Pillow 48529.0/50000: 97% mana
2.6/5: 52% soul_shard
2:07.142 aoe I rain_of_fire Fluffy_Pillow 48400.0/50000: 97% mana
3.0/5: 60% soul_shard
2:08.448 aoe L incinerate Fluffy_Pillow 49053.0/50000: 98% mana
0.3/5: 6% soul_shard
2:10.190 default A cataclysm Fluffy_Pillow 48924.0/50000: 98% mana
0.6/5: 12% soul_shard
2:11.929 aoe H havoc enemy2 49293.5/50000: 99% mana
1.0/5: 20% soul_shard
2:13.234 havoc N conflagrate Fluffy_Pillow 48946.0/50000: 98% mana
1.1/5: 22% soul_shard
2:14.541 havoc R chaos_bolt Fluffy_Pillow 49099.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:16.367 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
2:18.108 havoc S incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.0/5: 20% soul_shard
2:19.847 havoc N conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
1.8/5: 36% soul_shard
2:21.154 havoc Q immolate Fluffy_Pillow 49025.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
2:22.461 havoc P scouring_tithe Fluffy_Pillow 48929.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
2:24.200 default 9 soul_fire Fluffy_Pillow 48798.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
2:27.676 aoe E channel_demonfire Fluffy_Pillow 49001.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
2:30.553 aoe F immolate enemy3 49690.0/50000: 99% mana
5.0/5: 100% soul_shard
2:31.859 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
5.0/5: 100% soul_shard
2:33.166 aoe J conflagrate Fluffy_Pillow 49905.5/50000: 100% mana
2.3/5: 46% soul_shard
2:34.471 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
backdraft
2:35.689 aoe I rain_of_fire Fluffy_Pillow 49001.5/50000: 98% mana
3.4/5: 68% soul_shard
2:36.995 aoe J conflagrate Fluffy_Pillow 49654.5/50000: 99% mana
0.5/5: 10% soul_shard
2:38.302 aoe L incinerate Fluffy_Pillow 49808.0/50000: 100% mana
1.2/5: 24% soul_shard
backdraft
2:39.522 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.5/5: 30% soul_shard
2:41.262 aoe L incinerate Fluffy_Pillow 48872.5/50000: 98% mana
1.9/5: 38% soul_shard
2:43.002 default A cataclysm Fluffy_Pillow 48742.5/50000: 97% mana
2.3/5: 46% soul_shard
2:44.743 aoe H havoc enemy2 49113.0/50000: 98% mana
2.5/5: 50% soul_shard
2:46.049 havoc N conflagrate Fluffy_Pillow 48766.0/50000: 98% mana
2.7/5: 54% soul_shard
2:47.356 havoc P scouring_tithe Fluffy_Pillow 48919.5/50000: 98% mana
3.9/5: 78% soul_shard
backdraft
2:49.096 havoc R chaos_bolt Fluffy_Pillow 48789.5/50000: 98% mana
4.1/5: 82% soul_shard
backdraft
2:50.924 havoc R chaos_bolt Fluffy_Pillow 49703.5/50000: 99% mana
2.3/5: 46% soul_shard
2:53.535 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
2:55.275 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
2:56.581 havoc Q immolate Fluffy_Pillow 49155.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:57.887 aoe E channel_demonfire Fluffy_Pillow 49058.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
3:00.765 aoe F immolate enemy2 49747.0/50000: 99% mana
2.7/5: 54% soul_shard
backdraft
3:02.072 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
2.8/5: 56% soul_shard
backdraft
3:03.292 aoe F immolate enemy3 48862.5/50000: 98% mana
3.1/5: 62% soul_shard
3:04.598 cds M summon_infernal Fluffy_Pillow 48765.5/50000: 98% mana
3.2/5: 64% soul_shard
3:05.904 aoe D rain_of_fire Fluffy_Pillow 48418.5/50000: 97% mana
3.6/5: 72% soul_shard
3:07.212 aoe J conflagrate Fluffy_Pillow 49072.5/50000: 98% mana
1.0/5: 20% soul_shard
3:08.519 aoe K scouring_tithe Fluffy_Pillow 49226.0/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
3:10.261 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft, brons_call_to_action
3:11.480 aoe D rain_of_fire Fluffy_Pillow 48612.5/50000: 97% mana
3.0/5: 60% soul_shard
brons_call_to_action(2)
3:12.787 default 9 soul_fire Fluffy_Pillow 49266.0/50000: 99% mana
0.5/5: 10% soul_shard
brons_call_to_action(2)
3:16.266 default A cataclysm Fluffy_Pillow 49003.0/50000: 98% mana
2.8/5: 56% soul_shard
brons_call_to_action(3)
3:18.006 aoe H havoc enemy2 49373.0/50000: 99% mana
3.2/5: 64% soul_shard
brons_call_to_action(4)
3:19.311 havoc N conflagrate Fluffy_Pillow 49025.5/50000: 98% mana
3.6/5: 72% soul_shard
brons_call_to_action(4)
3:20.618 havoc R chaos_bolt Fluffy_Pillow 49179.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, brons_call_to_action(5)
3:22.445 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
brons_call_to_action(6)
3:23.750 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.7/5: 94% soul_shard
backdraft, brons_call_to_action(6)
3:25.577 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
brons_call_to_action(7)
3:28.189 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
brons_call_to_action(8)
3:29.496 havoc P scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
3.3/5: 66% soul_shard
backdraft, brons_call_to_action(8)
3:31.237 aoe D rain_of_fire Fluffy_Pillow 49002.5/50000: 98% mana
3.8/5: 76% soul_shard
backdraft, brons_call_to_action(9)
3:32.543 aoe F immolate Fluffy_Pillow 49655.5/50000: 99% mana
1.0/5: 20% soul_shard
backdraft, brons_call_to_action(9)
3:33.848 aoe E channel_demonfire Fluffy_Pillow 49251.5/50000: 99% mana
1.4/5: 28% soul_shard
backdraft, brons_call_to_action(10)
3:36.687 aoe F immolate enemy3 49921.0/50000: 100% mana
1.9/5: 38% soul_shard
backdraft, brons_call_to_action(10)
3:37.993 aoe F immolate enemy2 49252.0/50000: 99% mana
1.9/5: 38% soul_shard
backdraft, brons_call_to_action(11)
3:39.298 aoe J conflagrate Fluffy_Pillow 49154.5/50000: 98% mana
2.1/5: 42% soul_shard
brons_call_to_action(12)
3:40.603 aoe L incinerate Fluffy_Pillow 49307.0/50000: 99% mana
2.6/5: 52% soul_shard
backdraft, brons_call_to_action(12)
3:41.822 aoe I rain_of_fire Fluffy_Pillow 48916.5/50000: 98% mana
3.1/5: 62% soul_shard
brons_call_to_action(13)
3:43.128 aoe L incinerate Fluffy_Pillow 49569.5/50000: 99% mana
0.2/5: 4% soul_shard
brons_call_to_action(13)
3:44.869 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.8/5: 16% soul_shard
brons_call_to_action(14)
3:46.223 aoe L incinerate Fluffy_Pillow 49179.5/50000: 98% mana
1.3/5: 26% soul_shard
backdraft, brons_call_to_action(15)
3:47.444 aoe L incinerate Fluffy_Pillow 48790.0/50000: 98% mana
1.8/5: 36% soul_shard
brons_call_to_action(16)
3:49.184 default A cataclysm Fluffy_Pillow 48660.0/50000: 97% mana
2.0/5: 40% soul_shard
brons_call_to_action(17)
3:50.924 aoe H havoc enemy2 49030.0/50000: 98% mana
2.3/5: 46% soul_shard
brons_call_to_action(18)
3:52.233 havoc P scouring_tithe Fluffy_Pillow 48684.5/50000: 97% mana
2.5/5: 50% soul_shard
brons_call_to_action(18)
3:53.973 havoc N conflagrate Fluffy_Pillow 48554.5/50000: 97% mana
2.6/5: 52% soul_shard
brons_call_to_action(19)
3:55.280 havoc R chaos_bolt Fluffy_Pillow 48708.0/50000: 97% mana
3.9/5: 78% soul_shard
backdraft, brons_call_to_action(19)
3:57.107 havoc S incinerate Fluffy_Pillow 49621.5/50000: 99% mana
1.9/5: 38% soul_shard
brons_call_to_action(20)
3:58.848 havoc R chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
2.6/5: 52% soul_shard
brons_call_to_action(21)
4:01.458 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
brons_call_to_action(22)
4:02.763 havoc N conflagrate Fluffy_Pillow 49251.5/50000: 99% mana
1.3/5: 26% soul_shard
brons_call_to_action(23)
4:04.070 default 9 soul_fire Fluffy_Pillow 49405.0/50000: 99% mana
2.3/5: 46% soul_shard
backdraft, brons_call_to_action(23)
4:07.548 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
3.6/5: 72% soul_shard
backdraft, brons_call_to_action(24)
4:10.383 aoe F immolate enemy3 49670.0/50000: 99% mana
4.1/5: 82% soul_shard
backdraft, brons_call_to_action(24)
4:11.688 aoe I rain_of_fire Fluffy_Pillow 49251.5/50000: 99% mana
4.3/5: 86% soul_shard
backdraft, brons_call_to_action(25)
4:12.995 aoe J conflagrate Fluffy_Pillow 49905.0/50000: 100% mana
1.5/5: 30% soul_shard
brons_call_to_action(25)
4:14.301 aoe K scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
2.1/5: 42% soul_shard
backdraft, brons_call_to_action(26)
4:16.041 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, brons_call_to_action(27)
4:17.262 aoe L incinerate Fluffy_Pillow 48612.5/50000: 97% mana
2.6/5: 52% soul_shard
brons_call_to_action(28)
4:19.002 aoe I rain_of_fire Fluffy_Pillow 48482.5/50000: 97% mana
3.1/5: 62% soul_shard
brons_call_to_action(29)
4:20.307 aoe J conflagrate Fluffy_Pillow 49135.0/50000: 98% mana
0.1/5: 2% soul_shard
brons_call_to_action(29)
4:21.614 default A cataclysm Fluffy_Pillow 49288.5/50000: 99% mana
1.0/5: 20% soul_shard
backdraft, brons_call_to_action(30)
4:23.356 aoe H havoc enemy2 49503.0/50000: 99% mana
1.2/5: 24% soul_shard
backdraft, brons_call_to_action(31)
4:24.663 havoc S incinerate Fluffy_Pillow 49156.5/50000: 98% mana
1.2/5: 24% soul_shard
backdraft, brons_call_to_action(31)
4:25.883 havoc S incinerate Fluffy_Pillow 48766.5/50000: 98% mana
1.7/5: 34% soul_shard
brons_call_to_action(32)
4:27.621 havoc R chaos_bolt Fluffy_Pillow 48635.5/50000: 97% mana
2.4/5: 48% soul_shard
brons_call_to_action(33)
4:30.230 havoc S incinerate Fluffy_Pillow 49940.0/50000: 100% mana
0.7/5: 14% soul_shard
brons_call_to_action(34)
4:31.971 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
brons_call_to_action(35)
4:33.276 havoc Q immolate Fluffy_Pillow 49155.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, brons_call_to_action(35)
4:34.581 havoc P scouring_tithe Fluffy_Pillow 49057.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft, brons_call_to_action(36)
4:36.321 aoe E channel_demonfire Fluffy_Pillow 48927.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft, brons_call_to_action(37)
4:39.125 aoe I rain_of_fire Fluffy_Pillow 49579.5/50000: 99% mana
3.3/5: 66% soul_shard
backdraft, brons_call_to_action(37)
4:40.432 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
backdraft, brons_call_to_action(38)
4:41.652 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.8/5: 16% soul_shard
brons_call_to_action(39)
4:42.960 aoe F immolate enemy3 49156.5/50000: 98% mana
1.3/5: 26% soul_shard
backdraft, brons_call_to_action(39)
4:44.268 aoe L incinerate Fluffy_Pillow 49060.5/50000: 98% mana
1.6/5: 32% soul_shard
backdraft, brons_call_to_action(40)
4:45.488 aoe J conflagrate Fluffy_Pillow 48670.5/50000: 97% mana
1.8/5: 36% soul_shard
brons_call_to_action(41)
4:46.796 aoe L incinerate Fluffy_Pillow 48824.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft, brons_call_to_action(41)
4:48.015 aoe L incinerate Fluffy_Pillow 48434.0/50000: 97% mana
2.8/5: 56% soul_shard
brons_call_to_action(42)
4:49.757 aoe I rain_of_fire Fluffy_Pillow 48305.0/50000: 97% mana
3.4/5: 68% soul_shard
brons_call_to_action(43)
4:51.063 aoe L incinerate Fluffy_Pillow 48958.0/50000: 98% mana
0.4/5: 8% soul_shard
brons_call_to_action(43)
4:52.803 default 9 soul_fire Fluffy_Pillow 48828.0/50000: 98% mana
0.9/5: 18% soul_shard
brons_call_to_action(44)
4:56.281 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
2.2/5: 44% soul_shard
brons_call_to_action(45)
4:58.022 aoe E channel_demonfire Fluffy_Pillow 49373.0/50000: 99% mana
2.4/5: 48% soul_shard
brons_call_to_action(46)
5:00.744 aoe H havoc enemy2 49984.0/50000: 100% mana
2.7/5: 54% soul_shard
brons_call_to_action(47)
5:02.052 havoc N conflagrate Fluffy_Pillow 49638.0/50000: 99% mana
2.7/5: 54% soul_shard
brons_call_to_action(48)
5:03.360 havoc P scouring_tithe Fluffy_Pillow 49792.0/50000: 100% mana
4.0/5: 80% soul_shard
backdraft, brons_call_to_action(49)
5:05.100 havoc R chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
4.3/5: 86% soul_shard
backdraft, brons_call_to_action(50)
5:06.927 havoc N conflagrate Fluffy_Pillow 49915.5/50000: 100% mana
2.4/5: 48% soul_shard
brons_call_to_action(51)
5:08.234 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.6/5: 72% soul_shard
backdraft, brons_call_to_action(51)
5:10.062 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
brons_call_to_action(52)
5:11.370 havoc N conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
2.0/5: 40% soul_shard
brons_call_to_action(53)
5:12.716 aoe I rain_of_fire Fluffy_Pillow 49426.0/50000: 99% mana
3.0/5: 60% soul_shard
backdraft, brons_call_to_action(54)
5:14.022 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
backdraft, brons_call_to_action(55)
5:15.243 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
0.5/5: 10% soul_shard
brons_call_to_action(56)
5:16.984 aoe F immolate enemy3 48873.5/50000: 98% mana
1.0/5: 20% soul_shard
brons_call_to_action(57)
5:18.290 aoe L incinerate Fluffy_Pillow 48776.5/50000: 98% mana
1.3/5: 26% soul_shard
brons_call_to_action(58)
5:20.031 aoe E channel_demonfire Fluffy_Pillow 48647.0/50000: 97% mana
1.6/5: 32% soul_shard
brons_call_to_action(59)
5:22.911 aoe F immolate enemy2 49337.0/50000: 99% mana
1.9/5: 38% soul_shard
brons_call_to_action(59)

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Kyrian_Forgelite"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=kyrian
soulbind=333950/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Kyrian_Pelagos : 9623 dps, 5235 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9623.3 9623.3 17.1 / 0.177% 784.4 / 8.2% 20.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
407.8 404.8 Mana 0.00% 38.4 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_Pelagos 9623
Cataclysm 783 8.2% 9.7 32.37sec 24155 14216 Direct 29.1 6775 13543 8056 18.9%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.69 29.08 0.00 0.00 1.6992 0.0000 234131.80 234131.80 0.00% 14215.65 14215.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.14% 23.59 15 32 6775.32 6141 8265 6773.70 6514 7211 159840 159840 0.00%
crit 18.86% 5.48 0 12 13543.10 12283 16525 13524.02 0 15241 74292 74292 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.74
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1037) 0.0% (10.8%) 11.9 25.91sec 26004 9610

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.91 0.00 177.72 0.00 2.7059 0.1643 0.00 0.00 0.00% 9610.10 9610.10

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:11.91
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1037 10.8% 0.0 0.00sec 0 0 Direct 533.2 487 977 581 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 533.16 0.00 0.00 0.0000 0.0000 309714.43 309714.43 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 430.42 303 559 486.57 263 1111 486.86 458 525 209429 209429 0.00%
crit 19.27% 102.74 62 150 976.69 525 2222 977.20 840 1126 100286 100286 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1183 (1572) 12.3% (16.3%) 18.8 15.30sec 24974 12568 Direct 37.4 (73.7) 0 9443 9443 100.0% (60.2%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.78 37.38 0.00 0.00 1.9872 0.0000 352883.43 352883.43 0.00% 12568.21 12568.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 37.38 26 50 9443.43 5868 13934 9443.21 9046 9894 352883 352883 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [R]:18.88
  • if_expr:cast_time<havoc_remains
    Internal Combustion 389 4.0% 36.3 15.37sec 3193 0 Direct 36.3 2670 5397 3195 19.2%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.34 36.34 0.00 0.00 0.0000 0.0000 116036.65 116036.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 29.35 18 41 2670.19 1 4229 2674.20 2418 2955 78361 78361 0.00%
crit 19.22% 6.98 1 17 5397.17 9 8455 5404.22 1597 7450 37676 37676 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 824 8.6% 36.8 7.97sec 6697 5360 Direct 54.8 3759 7526 4488 19.4%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.76 54.85 0.00 0.00 1.2494 0.0000 246205.06 246205.06 0.00% 5360.09 5360.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.59% 44.20 30 57 3758.71 2047 5739 3758.89 3460 4038 166136 166136 0.00%
crit 19.41% 10.64 2 24 7525.91 4094 11473 7510.48 4224 9627 80069 80069 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.67
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.09
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1646 17.1% 25.3 11.37sec 19469 15464 Direct 31.5 1591 3187 1891 18.8%
Periodic 345.5 1051 2100 1252 19.2% 95.6%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.28 31.47 345.46 345.46 1.2590 2.4822 492125.64 492125.64 0.00% 553.37 15463.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.16% 25.54 16 36 1590.95 819 2296 1591.75 1448 1734 40632 40632 0.00%
crit 18.84% 5.93 1 14 3186.79 1638 4591 3195.42 2268 4533 18901 18901 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.78% 279.07 203 349 1050.53 0 1435 1050.65 1029 1079 293150 293150 0.00%
crit 19.22% 66.39 39 98 2099.97 3 2870 2100.60 1965 2216 139443 139443 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:17.60
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [Q]:7.80
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 576 6.0% 39.3 7.15sec 4383 3110 Direct 49.9 (49.9) 2887 5778 3456 19.6% (19.6%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.33 49.91 0.00 0.00 1.4091 0.0000 172402.87 172402.87 0.00% 3110.45 3110.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.36% 40.11 25 59 2886.53 1331 3900 2887.78 2664 3070 115770 115770 0.00%
crit 19.64% 9.80 2 20 5777.69 2768 7800 5774.75 4029 6783 56633 56633 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:28.64
    havoc
    [S]:10.91
  • if_expr:cast_time<havoc_remains
Rain of Fire 1000 10.4% 18.4 15.80sec 16232 13077 Periodic 437.2 573 1146 683 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.40 0.00 0.00 437.20 1.2413 0.0000 298623.28 298623.28 0.00% 13077.44 13077.44
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.71% 352.88 243 474 572.51 507 682 572.53 556 587 202027 202027 0.00%
crit 19.29% 84.32 54 126 1145.57 1013 1364 1145.58 1116 1190 96597 96597 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:6.51
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.87
Scouring Tithe 329 3.4% 13.3 22.76sec 7372 4386 Direct 18.7 1484 2951 1764 19.0%
Periodic 132.7 413 826 493 19.3% 36.3%

Stats Details: Scouring Tithe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.34 18.70 132.71 132.71 1.6806 2.4559 98365.63 98365.63 0.00% 282.38 4386.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.03% 15.15 8 21 1483.83 1004 1674 1484.45 1376 1629 22479 22479 0.00%
crit 18.97% 3.55 0 10 2951.34 2009 3348 2878.39 0 3348 10475 10475 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.69% 107.09 73 144 413.10 123 419 413.08 410 416 44237 44237 0.00%
crit 19.31% 25.62 9 42 826.35 246 837 826.40 793 837 21175 21175 0.00%

Action Details: Scouring Tithe

  • id:312321
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.150000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:312321
  • name:Scouring Tithe
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Deal {$s1=0 + 60.0%} Arcane damage instantly, and $o2 over {$d=18 seconds}. If the enemy dies while affected by Scouring Tithe, you generate $?a137043[${{$s3=50}/10}]?a137044[${{$s4=50}/10}][${{$s5=50}/10}] Soul $LShard:Shards;. If they survive, Scouring Tithe's cooldown is refreshed.

Action Priority List

    aoe
    [K]:6.68
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    havoc
    [P]:6.73
Soul Fire 484 5.0% 5.5 49.50sec 26219 7540 Direct 7.4 16442 32839 19642 19.6%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.52 7.37 0.00 0.00 3.4775 0.0000 144856.26 144856.26 0.00% 7539.88 7539.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.39% 5.92 2 11 16442.25 8599 24058 16504.56 13335 20367 97378 97378 0.00%
crit 19.61% 1.44 0 5 32838.56 17201 47989 25899.08 0 43370 47478 47478 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.70
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:0.92
  • if_expr:cast_time<havoc_remains
Summon Infernal 82 0.8% 2.0 180.54sec 12056 10429 Direct 6.0 3348 6696 4024 20.0%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24111.93 24111.93 0.00% 10429.04 10429.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.97% 4.80 0 6 3348.13 3348 3348 3342.78 0 3348 16066 16066 0.00%
crit 20.03% 1.20 0 6 6696.27 6696 6696 4939.17 0 6696 8046 8046 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3819 / 777
Immolation 3554 7.4% 39.0 5.49sec 5468 0 Direct 117.0 1530 3055 1823 19.2%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 213236.83 213236.83 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.80% 94.54 80 108 1529.55 1395 2023 1529.51 1498 1553 144595 144595 0.00%
crit 19.20% 22.46 9 37 3055.45 2790 4046 3055.19 2790 3370 68642 68642 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.6% 41.0 5.25sec 388 270 Direct 41.0 326 651 388 19.2%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15907.78 22722.68 29.99% 270.06 270.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.82% 33.14 25 40 325.55 326 326 325.55 326 326 10787 15409 29.99%
crit 19.18% 7.86 1 16 651.10 651 651 651.10 651 651 5120 7314 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 513 / 513
Firebolt 513 5.3% 93.0 3.22sec 1648 1132 Direct 92.3 1395 2790 1661 19.1%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.02 92.30 0.00 0.00 1.4558 0.0000 153317.80 153317.80 0.00% 1132.16 1132.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.93% 74.70 53 96 1395.06 1395 1395 1395.06 1395 1395 104212 104212 0.00%
crit 19.07% 17.60 5 29 2790.11 2790 2790 2790.11 2790 2790 49106 49106 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.47
Simple Action Stats Execute Interval
Kyrian_Pelagos
Havoc 9.6 32.21sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.63 0.00 0.00 0.00 1.2442 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.63
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.8 0.0 8.0sec 8.0sec 4.5sec 54.78% 0.00% 0.0 (0.0) 3.1

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 23.1s
  • trigger_min/max:1.9s / 23.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:54.78%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.56% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.56%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combat Meditation 4.8 0.0 67.9sec 67.9sec 18.5sec 29.43% 0.00% 27.7 (27.7) 4.5

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_combat_meditation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Stat Details

  • stat:mastery_rating
  • amount:350.00

Trigger Details

  • interval_min/max:60.3s / 87.5s
  • trigger_min/max:60.3s / 87.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.0s

Stack Uptimes

  • combat_meditation_1:29.43%

Spelldata

  • id:328908
  • name:Combat Meditation
  • tooltip:Mastery increased by $w.
  • description:{$@spelldesc328266=$?a137005[Shackle the Unworthy]?a212611[Elysian Decree]?a137009[Kindred Spirits]?a137014[Resonating Arrow]?a137018[Radiant Spark]?a137022[Weapons of Order]?a137026[Divine Toll]?a137030[Boon of the Ascended]?a137034[Echoing Reprimand]?a137038[Vesper Totem]?a137042[Scouring Tithe]?a137047[Spear of Bastion][Activating your Kyrian class ability] increases your Mastery by $328908m1 for ${{$328908d=10 seconds}*$<mod>}.1 sec and occasionally expels Sorrowful Memories. Walking through Sorrowful Memories extends this effect by ${$328913m2*$<mod>}.1 sec. $?a137018|?a137034[Combat Meditation may only occur once every {$345861d=60 seconds}.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 185.9s
  • trigger_min/max:180.0s / 185.9s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 185.9s
  • trigger_min/max:180.0s / 185.9s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 10.97% 7.68% 14.03% 0.7s 0.0s 6.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_Pelagos
soul_fire Soul Shard 6.53 6.94 7.37% 1.06 0.49 6.61%
immolate Soul Shard 345.46 33.26 35.33% 0.10 1.29 3.74%
incinerate Soul Shard 39.34 10.01 10.63% 0.25 0.03 0.30%
conflagrate Soul Shard 36.76 27.42 29.12% 0.75 0.00 0.00%
mana_regen Mana 658.20 121082.12 100.00% 183.96 28165.63 18.87%
immolate_crits Soul Shard 33.14 3.20 3.40% 0.10 0.12 3.53%
incinerate_crits Soul Shard 9.83 0.98 1.04% 0.10 0.00 0.08%
infernal Soul Shard 120.00 10.31 10.95% 0.09 1.69 14.07%
souring_tithe Soul Shard 1.02 2.02 2.15% 1.99 3.07 60.28%
pet - imp
energy_regen Energy 360.01 3550.34 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 404.82 407.79 28178.8 49112.0 47481.5 50000.0
Soul Shard 4.0 0.31 0.31 6.7 4.4 0.0 5.0
Usage Type Count Total Avg RPE APR
Kyrian_Pelagos
cataclysm Mana 9.7 4850.2 500.0 500.4 48.3
channel_demonfire Mana 11.9 8931.0 750.0 749.8 34.7
chaos_bolt Soul Shard 18.8 37.5 2.0 2.0 12489.7
conflagrate Mana 36.8 18379.1 500.0 499.9 13.4
havoc Mana 9.6 9631.8 1000.0 1000.5 0.0
immolate Mana 25.3 18955.9 750.0 749.9 26.0
incinerate Mana 39.3 39344.8 1000.0 1000.3 4.4
rain_of_fire Soul Shard 18.4 55.2 3.0 3.0 5414.6
scouring_tithe Mana 13.3 13343.2 1000.0 999.9 7.4
soul_fire Mana 6.5 6533.5 1000.0 1182.6 22.2
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.1
pet - imp
firebolt Energy 93.0 3720.9 40.0 40.0 41.2

Statistics & Data Analysis

Fight Length
Kyrian_Pelagos Fight Length
Count 625
Mean 299.05
Minimum 240.24
Maximum 359.94
Spread ( max - min ) 119.70
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Kyrian_Pelagos Damage Per Second
Count 625
Mean 9623.33
Minimum 9038.36
Maximum 10307.14
Spread ( max - min ) 1268.78
Range [ ( max - min ) / 2 * 100% ] 6.59%
Standard Deviation 217.6350
5th Percentile 9304.07
95th Percentile 9994.16
( 95th Percentile - 5th Percentile ) 690.09
Mean Distribution
Standard Deviation 8.7054
95.00% Confidence Interval ( 9606.27 - 9640.39 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1965
0.1 Scale Factor Error with Delta=300 405
0.05 Scale Factor Error with Delta=300 1618
0.01 Scale Factor Error with Delta=300 40434
Priority Target DPS
Kyrian_Pelagos Priority Target Damage Per Second
Count 625
Mean 5235.49
Minimum 4878.67
Maximum 5733.91
Spread ( max - min ) 855.24
Range [ ( max - min ) / 2 * 100% ] 8.17%
Standard Deviation 130.4092
5th Percentile 5043.49
95th Percentile 5454.12
( 95th Percentile - 5th Percentile ) 410.63
Mean Distribution
Standard Deviation 5.2164
95.00% Confidence Interval ( 5225.26 - 5245.71 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2384
0.1 Scale Factor Error with Delta=300 146
0.05 Scale Factor Error with Delta=300 581
0.01 Scale Factor Error with Delta=300 14518
DPS(e)
Kyrian_Pelagos Damage Per Second (Effective)
Count 625
Mean 9623.33
Minimum 9038.36
Maximum 10307.14
Spread ( max - min ) 1268.78
Range [ ( max - min ) / 2 * 100% ] 6.59%
Damage
Kyrian_Pelagos Damage
Count 625
Mean 2489456.98
Minimum 2002572.63
Maximum 3004281.82
Spread ( max - min ) 1001709.19
Range [ ( max - min ) / 2 * 100% ] 20.12%
DTPS
Kyrian_Pelagos Damage Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_Pelagos Healing Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_Pelagos Healing Per Second (Effective)
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_Pelagos Heal
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_Pelagos Healing Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_Pelagos Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_PelagosTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_Pelagos Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.70 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.74 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 6.51 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 11.91 channel_demonfire,if=dot.immolate.remains>cast_time
F 17.60 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.63 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.87 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.67 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
K 6.68 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 28.64 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.09 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 0.92 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
P 6.73 scouring_tithe
Q 7.80 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
R 18.88 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
S 10.91 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHPRNRNQRNDFLEDFFJKLDJLJADLHNRSSRQP9EFJILJLJLAHPRNRSQEJILFLJKLFLIA9EHNRNPRNQLFILJELLAJIKHSSNRSQE9FIJKLJIALLHNRSSNQPEIFLMJDLLJADHOPRNSDEDFJLFFJIKLAHNRSSNRQEFJK9FILJLLAHNRRPNQEILLFJLLLFIJKAE9HNRNRRPQFFEJLJIA

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.741 aoe E channel_demonfire Fluffy_Pillow 49370.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.888 cds M summon_infernal Fluffy_Pillow 49694.0/50000: 99% mana
4.3/5: 86% soul_shard
bloodlust
0:04.893 aoe H havoc enemy2 49196.5/50000: 98% mana
4.5/5: 90% soul_shard
bloodlust
0:05.901 havoc P scouring_tithe Fluffy_Pillow 48700.5/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:07.240 havoc R chaos_bolt Fluffy_Pillow 48370.0/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust, combat_meditation
0:09.246 havoc N conflagrate Fluffy_Pillow 49373.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust, combat_meditation
0:10.254 havoc R chaos_bolt Fluffy_Pillow 49377.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, combat_meditation
0:11.660 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust, combat_meditation
0:12.667 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft, combat_meditation
0:13.674 havoc R chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, combat_meditation
0:15.078 havoc N conflagrate Fluffy_Pillow 49954.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, combat_meditation
0:16.085 aoe D rain_of_fire Fluffy_Pillow 49958.0/50000: 100% mana
4.6/5: 92% soul_shard
bloodlust, backdraft, combat_meditation
0:17.093 aoe F immolate enemy3 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
bloodlust, backdraft, combat_meditation
0:18.102 aoe L incinerate Fluffy_Pillow 49253.5/50000: 99% mana
2.3/5: 46% soul_shard
bloodlust, backdraft, combat_meditation
0:19.044 aoe E channel_demonfire Fluffy_Pillow 48724.5/50000: 97% mana
2.7/5: 54% soul_shard
bloodlust, combat_meditation
0:21.258 aoe D rain_of_fire Fluffy_Pillow 49081.5/50000: 98% mana
3.4/5: 68% soul_shard
bloodlust, combat_meditation
0:22.264 aoe F immolate enemy2 49584.5/50000: 99% mana
0.9/5: 18% soul_shard
bloodlust, combat_meditation
0:23.270 aoe F immolate Fluffy_Pillow 49252.0/50000: 99% mana
1.1/5: 22% soul_shard
bloodlust, combat_meditation
0:24.275 aoe J conflagrate Fluffy_Pillow 49004.5/50000: 98% mana
1.6/5: 32% soul_shard
bloodlust, combat_meditation
0:25.280 aoe K scouring_tithe Fluffy_Pillow 49007.0/50000: 98% mana
2.3/5: 46% soul_shard
bloodlust, backdraft, combat_meditation
0:26.618 aoe L incinerate Fluffy_Pillow 48676.0/50000: 97% mana
2.9/5: 58% soul_shard
bloodlust, backdraft
0:27.558 aoe D rain_of_fire Fluffy_Pillow 48146.0/50000: 96% mana
3.3/5: 66% soul_shard
bloodlust
0:28.566 aoe J conflagrate Fluffy_Pillow 48650.0/50000: 97% mana
0.8/5: 16% soul_shard
bloodlust
0:29.572 aoe L incinerate Fluffy_Pillow 48653.0/50000: 97% mana
1.5/5: 30% soul_shard
bloodlust, backdraft
0:30.511 aoe J conflagrate Fluffy_Pillow 48122.5/50000: 96% mana
2.2/5: 44% soul_shard
bloodlust
0:31.518 default A cataclysm Fluffy_Pillow 48126.0/50000: 96% mana
2.9/5: 58% soul_shard
bloodlust, backdraft
0:33.077 aoe D rain_of_fire Fluffy_Pillow 48405.5/50000: 97% mana
3.5/5: 70% soul_shard
bloodlust, backdraft
0:34.085 aoe L incinerate Fluffy_Pillow 48909.5/50000: 98% mana
1.0/5: 20% soul_shard
bloodlust, backdraft
0:35.025 aoe H havoc enemy2 48379.5/50000: 97% mana
1.2/5: 24% soul_shard
bloodlust
0:36.032 havoc N conflagrate Fluffy_Pillow 47883.0/50000: 96% mana
1.5/5: 30% soul_shard
bloodlust
0:37.039 havoc R chaos_bolt Fluffy_Pillow 47886.5/50000: 96% mana
2.6/5: 52% soul_shard
bloodlust, backdraft
0:38.445 havoc S incinerate Fluffy_Pillow 48589.5/50000: 97% mana
0.9/5: 18% soul_shard
bloodlust
0:39.786 havoc S incinerate Fluffy_Pillow 48260.0/50000: 97% mana
1.6/5: 32% soul_shard
bloodlust
0:41.129 havoc R chaos_bolt Fluffy_Pillow 47931.5/50000: 96% mana
2.1/5: 42% soul_shard
0:43.736 havoc Q immolate Fluffy_Pillow 49235.0/50000: 98% mana
0.5/5: 10% soul_shard
0:45.044 havoc P scouring_tithe Fluffy_Pillow 49139.0/50000: 98% mana
0.8/5: 16% soul_shard
0:46.784 default 9 soul_fire Fluffy_Pillow 49002.0/50000: 98% mana
0.8/5: 16% soul_shard
0:50.261 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
0:53.071 aoe F immolate enemy3 49657.0/50000: 99% mana
2.8/5: 56% soul_shard
0:54.376 aoe J conflagrate Fluffy_Pillow 49251.5/50000: 99% mana
2.8/5: 56% soul_shard
0:55.682 aoe I rain_of_fire Fluffy_Pillow 49404.5/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
0:56.988 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
0:58.207 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
0:59.512 aoe L incinerate Fluffy_Pillow 49154.5/50000: 98% mana
1.6/5: 32% soul_shard
backdraft
1:00.732 aoe J conflagrate Fluffy_Pillow 48764.5/50000: 98% mana
2.1/5: 42% soul_shard
1:02.038 aoe L incinerate Fluffy_Pillow 48917.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
1:03.258 default A cataclysm Fluffy_Pillow 48527.5/50000: 97% mana
3.2/5: 64% soul_shard
1:05.000 aoe H havoc enemy2 48898.5/50000: 98% mana
3.3/5: 66% soul_shard
1:06.333 havoc P scouring_tithe Fluffy_Pillow 48565.0/50000: 97% mana
3.6/5: 72% soul_shard
1:08.075 havoc R chaos_bolt Fluffy_Pillow 48436.0/50000: 97% mana
3.9/5: 78% soul_shard
combat_meditation
1:10.683 havoc N conflagrate Fluffy_Pillow 49740.0/50000: 99% mana
2.2/5: 44% soul_shard
combat_meditation
1:11.988 havoc R chaos_bolt Fluffy_Pillow 49892.5/50000: 100% mana
3.2/5: 64% soul_shard
backdraft, combat_meditation
1:13.815 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
combat_meditation
1:15.556 havoc Q immolate Fluffy_Pillow 49002.5/50000: 98% mana
2.1/5: 42% soul_shard
combat_meditation
1:16.863 aoe E channel_demonfire Fluffy_Pillow 48906.0/50000: 98% mana
2.3/5: 46% soul_shard
combat_meditation
1:19.698 aoe J conflagrate Fluffy_Pillow 49573.5/50000: 99% mana
2.6/5: 52% soul_shard
combat_meditation
1:21.005 aoe I rain_of_fire Fluffy_Pillow 49727.0/50000: 99% mana
3.3/5: 66% soul_shard
backdraft, combat_meditation
1:22.312 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
backdraft, combat_meditation
1:23.531 aoe F immolate enemy3 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
combat_meditation
1:24.838 aoe L incinerate Fluffy_Pillow 48905.5/50000: 98% mana
1.1/5: 22% soul_shard
combat_meditation
1:26.577 aoe J conflagrate Fluffy_Pillow 48775.0/50000: 98% mana
1.5/5: 30% soul_shard
combat_meditation
1:27.882 aoe K scouring_tithe Fluffy_Pillow 48927.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
1:29.624 aoe L incinerate Fluffy_Pillow 48798.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
1:30.843 aoe F immolate enemy2 48408.0/50000: 97% mana
2.7/5: 54% soul_shard
1:32.149 aoe L incinerate Fluffy_Pillow 48311.0/50000: 97% mana
2.9/5: 58% soul_shard
1:33.891 aoe I rain_of_fire Fluffy_Pillow 48182.0/50000: 96% mana
3.4/5: 68% soul_shard
1:35.196 default A cataclysm Fluffy_Pillow 48834.5/50000: 98% mana
0.6/5: 12% soul_shard
1:36.934 default 9 soul_fire Fluffy_Pillow 49203.5/50000: 98% mana
0.8/5: 16% soul_shard
1:40.412 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
2.2/5: 44% soul_shard
1:43.285 aoe H havoc enemy2 49689.0/50000: 99% mana
2.5/5: 50% soul_shard
1:44.591 havoc N conflagrate Fluffy_Pillow 49342.0/50000: 99% mana
2.6/5: 52% soul_shard
1:45.898 havoc R chaos_bolt Fluffy_Pillow 49495.5/50000: 99% mana
3.8/5: 76% soul_shard
backdraft
1:47.725 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.0/5: 40% soul_shard
1:49.031 havoc P scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
3.1/5: 62% soul_shard
backdraft
1:50.771 havoc R chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
1:52.598 havoc N conflagrate Fluffy_Pillow 49915.5/50000: 100% mana
1.6/5: 32% soul_shard
1:53.903 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
backdraft
1:55.211 aoe L incinerate Fluffy_Pillow 49253.0/50000: 99% mana
2.9/5: 58% soul_shard
backdraft
1:56.432 aoe F immolate enemy3 48863.5/50000: 98% mana
3.1/5: 62% soul_shard
1:57.739 aoe I rain_of_fire Fluffy_Pillow 48767.0/50000: 98% mana
3.2/5: 64% soul_shard
1:59.047 aoe L incinerate Fluffy_Pillow 49421.0/50000: 99% mana
0.4/5: 8% soul_shard
2:00.788 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.0/5: 20% soul_shard
2:02.113 aoe E channel_demonfire Fluffy_Pillow 49165.0/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
2:04.976 aoe L incinerate Fluffy_Pillow 49846.5/50000: 100% mana
1.8/5: 36% soul_shard
backdraft
2:06.194 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
2.3/5: 46% soul_shard
2:07.936 default A cataclysm Fluffy_Pillow 48872.5/50000: 98% mana
2.6/5: 52% soul_shard
2:09.677 aoe J conflagrate Fluffy_Pillow 49243.0/50000: 98% mana
2.8/5: 56% soul_shard
2:10.983 aoe I rain_of_fire Fluffy_Pillow 49396.0/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
2:12.290 aoe K scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
2:14.030 aoe H havoc enemy2 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
backdraft, combat_meditation
2:15.336 havoc S incinerate Fluffy_Pillow 48655.0/50000: 97% mana
0.9/5: 18% soul_shard
backdraft, combat_meditation
2:16.554 havoc S incinerate Fluffy_Pillow 48264.0/50000: 97% mana
1.6/5: 32% soul_shard
combat_meditation
2:18.294 havoc N conflagrate Fluffy_Pillow 48134.0/50000: 96% mana
2.1/5: 42% soul_shard
combat_meditation
2:19.599 havoc R chaos_bolt Fluffy_Pillow 48286.5/50000: 97% mana
3.3/5: 66% soul_shard
backdraft, combat_meditation
2:21.427 havoc S incinerate Fluffy_Pillow 49200.5/50000: 98% mana
1.9/5: 38% soul_shard
combat_meditation
2:23.168 havoc Q immolate Fluffy_Pillow 49002.5/50000: 98% mana
2.3/5: 46% soul_shard
combat_meditation
2:24.475 aoe E channel_demonfire Fluffy_Pillow 48906.0/50000: 98% mana
2.7/5: 54% soul_shard
combat_meditation
2:27.262 default 9 soul_fire Fluffy_Pillow 49549.5/50000: 99% mana
3.0/5: 60% soul_shard
combat_meditation
2:30.738 aoe F immolate enemy3 49001.5/50000: 98% mana
4.3/5: 86% soul_shard
combat_meditation
2:32.046 aoe I rain_of_fire Fluffy_Pillow 48905.5/50000: 98% mana
4.6/5: 92% soul_shard
combat_meditation
2:33.353 aoe J conflagrate Fluffy_Pillow 49559.0/50000: 99% mana
1.6/5: 32% soul_shard
2:34.660 aoe K scouring_tithe Fluffy_Pillow 49712.5/50000: 99% mana
2.4/5: 48% soul_shard
backdraft
2:36.402 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:37.623 aoe J conflagrate Fluffy_Pillow 48613.5/50000: 97% mana
2.9/5: 58% soul_shard
2:38.930 aoe I rain_of_fire Fluffy_Pillow 48767.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
2:40.237 default A cataclysm Fluffy_Pillow 49420.5/50000: 99% mana
0.7/5: 14% soul_shard
backdraft
2:41.977 aoe L incinerate Fluffy_Pillow 49502.0/50000: 99% mana
0.8/5: 16% soul_shard
backdraft
2:43.197 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
2:44.938 aoe H havoc enemy2 48873.0/50000: 98% mana
1.8/5: 36% soul_shard
2:46.244 havoc N conflagrate Fluffy_Pillow 48526.0/50000: 97% mana
1.8/5: 36% soul_shard
2:47.548 havoc R chaos_bolt Fluffy_Pillow 48678.0/50000: 97% mana
3.2/5: 64% soul_shard
backdraft
2:49.375 havoc S incinerate Fluffy_Pillow 49591.5/50000: 99% mana
1.2/5: 24% soul_shard
2:51.118 havoc S incinerate Fluffy_Pillow 49003.5/50000: 98% mana
1.9/5: 38% soul_shard
2:52.858 havoc N conflagrate Fluffy_Pillow 48873.5/50000: 98% mana
2.6/5: 52% soul_shard
2:54.166 havoc Q immolate Fluffy_Pillow 49027.5/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
2:55.471 havoc P scouring_tithe Fluffy_Pillow 48930.0/50000: 98% mana
3.9/5: 78% soul_shard
backdraft
2:57.211 aoe E channel_demonfire Fluffy_Pillow 48800.0/50000: 98% mana
3.9/5: 78% soul_shard
backdraft
3:00.092 aoe I rain_of_fire Fluffy_Pillow 49490.5/50000: 99% mana
4.3/5: 86% soul_shard
backdraft
3:01.399 aoe F immolate enemy3 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
backdraft
3:02.705 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
1.6/5: 32% soul_shard
backdraft
3:03.922 cds M summon_infernal Fluffy_Pillow 48860.5/50000: 98% mana
2.0/5: 40% soul_shard
3:05.230 aoe J conflagrate Fluffy_Pillow 48514.5/50000: 97% mana
2.3/5: 46% soul_shard
3:06.535 aoe D rain_of_fire Fluffy_Pillow 48667.0/50000: 97% mana
3.5/5: 70% soul_shard
backdraft
3:07.840 aoe L incinerate Fluffy_Pillow 49319.5/50000: 99% mana
0.8/5: 16% soul_shard
backdraft
3:09.060 aoe L incinerate Fluffy_Pillow 48929.5/50000: 98% mana
1.5/5: 30% soul_shard
3:10.801 aoe J conflagrate Fluffy_Pillow 48800.0/50000: 98% mana
2.4/5: 48% soul_shard
3:12.109 default A cataclysm Fluffy_Pillow 48954.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
3:13.850 aoe D rain_of_fire Fluffy_Pillow 49324.5/50000: 99% mana
3.8/5: 76% soul_shard
backdraft
3:15.157 aoe H havoc enemy2 49978.0/50000: 100% mana
1.1/5: 22% soul_shard
backdraft
3:16.464 havoc O soul_fire Fluffy_Pillow 49631.5/50000: 99% mana
1.8/5: 36% soul_shard
backdraft
3:19.942 havoc P scouring_tithe Fluffy_Pillow 49002.5/50000: 98% mana
4.8/5: 96% soul_shard
backdraft
3:21.683 havoc R chaos_bolt Fluffy_Pillow 48873.0/50000: 98% mana
5.0/5: 100% soul_shard
combat_meditation
3:24.290 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
combat_meditation
3:25.597 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft, combat_meditation
3:26.816 aoe D rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
combat_meditation
3:28.123 aoe E channel_demonfire Fluffy_Pillow 49655.5/50000: 99% mana
2.3/5: 46% soul_shard
combat_meditation
3:31.047 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.4/5: 68% soul_shard
combat_meditation
3:32.353 aoe F immolate enemy3 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
combat_meditation
3:33.659 aoe J conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
1.2/5: 24% soul_shard
combat_meditation
3:34.964 aoe L incinerate Fluffy_Pillow 49404.5/50000: 99% mana
2.1/5: 42% soul_shard
backdraft, combat_meditation
3:36.184 aoe F immolate Fluffy_Pillow 49002.5/50000: 98% mana
2.3/5: 46% soul_shard
combat_meditation
3:37.490 aoe F immolate enemy2 48905.5/50000: 98% mana
2.6/5: 52% soul_shard
combat_meditation
3:38.794 aoe J conflagrate Fluffy_Pillow 48807.5/50000: 98% mana
2.7/5: 54% soul_shard
combat_meditation
3:40.098 aoe I rain_of_fire Fluffy_Pillow 48959.5/50000: 98% mana
3.5/5: 70% soul_shard
backdraft, combat_meditation
3:41.403 aoe K scouring_tithe Fluffy_Pillow 49612.0/50000: 99% mana
0.5/5: 10% soul_shard
backdraft
3:43.144 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
0.8/5: 16% soul_shard
backdraft
3:44.364 default A cataclysm Fluffy_Pillow 48612.5/50000: 97% mana
1.1/5: 22% soul_shard
3:46.105 aoe H havoc enemy2 48983.0/50000: 98% mana
1.3/5: 26% soul_shard
3:47.411 havoc N conflagrate Fluffy_Pillow 48636.0/50000: 97% mana
1.6/5: 32% soul_shard
3:48.716 havoc R chaos_bolt Fluffy_Pillow 48788.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
3:50.543 havoc S incinerate Fluffy_Pillow 49702.0/50000: 99% mana
0.9/5: 18% soul_shard
3:52.284 havoc S incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
3:54.025 havoc N conflagrate Fluffy_Pillow 48873.0/50000: 98% mana
2.0/5: 40% soul_shard
3:55.332 havoc R chaos_bolt Fluffy_Pillow 49026.5/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
3:57.158 havoc Q immolate Fluffy_Pillow 49939.5/50000: 100% mana
1.4/5: 28% soul_shard
3:58.464 aoe E channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
1.7/5: 34% soul_shard
4:01.277 aoe F immolate enemy2 49908.5/50000: 100% mana
2.0/5: 40% soul_shard
4:02.584 aoe J conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
2.1/5: 42% soul_shard
4:03.890 aoe K scouring_tithe Fluffy_Pillow 49405.5/50000: 99% mana
2.7/5: 54% soul_shard
backdraft
4:05.630 default 9 soul_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
4:09.108 aoe F immolate enemy3 49002.5/50000: 98% mana
4.3/5: 86% soul_shard
backdraft
4:10.414 aoe I rain_of_fire Fluffy_Pillow 48905.5/50000: 98% mana
4.5/5: 90% soul_shard
backdraft
4:11.720 aoe L incinerate Fluffy_Pillow 49558.5/50000: 99% mana
1.6/5: 32% soul_shard
backdraft
4:12.939 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.8/5: 36% soul_shard
4:14.246 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
4:15.466 aoe L incinerate Fluffy_Pillow 48765.5/50000: 98% mana
2.8/5: 56% soul_shard
4:17.207 default A cataclysm Fluffy_Pillow 48636.0/50000: 97% mana
3.3/5: 66% soul_shard
4:18.947 aoe H havoc enemy2 49006.0/50000: 98% mana
3.7/5: 74% soul_shard
4:20.256 havoc N conflagrate Fluffy_Pillow 48660.5/50000: 97% mana
3.7/5: 74% soul_shard
4:21.564 havoc R chaos_bolt Fluffy_Pillow 48814.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
4:23.393 havoc R chaos_bolt Fluffy_Pillow 49729.0/50000: 99% mana
3.0/5: 60% soul_shard
4:26.003 havoc P scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
4:27.743 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.6/5: 32% soul_shard
combat_meditation
4:29.147 havoc Q immolate Fluffy_Pillow 49204.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft, combat_meditation
4:30.452 aoe E channel_demonfire Fluffy_Pillow 49106.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft, combat_meditation
4:33.177 aoe I rain_of_fire Fluffy_Pillow 49719.0/50000: 99% mana
3.2/5: 64% soul_shard
backdraft, combat_meditation
4:34.483 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
backdraft, combat_meditation
4:35.701 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
0.8/5: 16% soul_shard
combat_meditation
4:37.442 aoe F immolate enemy3 48872.0/50000: 98% mana
1.2/5: 24% soul_shard
combat_meditation
4:38.749 aoe J conflagrate Fluffy_Pillow 48775.5/50000: 98% mana
1.3/5: 26% soul_shard
combat_meditation
4:40.056 aoe L incinerate Fluffy_Pillow 48929.0/50000: 98% mana
2.0/5: 40% soul_shard
backdraft, combat_meditation
4:41.274 aoe L incinerate Fluffy_Pillow 48538.0/50000: 97% mana
2.3/5: 46% soul_shard
combat_meditation
4:43.013 aoe L incinerate Fluffy_Pillow 48407.5/50000: 97% mana
2.7/5: 54% soul_shard
combat_meditation
4:44.753 aoe F immolate enemy2 48277.5/50000: 97% mana
3.2/5: 64% soul_shard
combat_meditation
4:46.059 aoe I rain_of_fire Fluffy_Pillow 48180.5/50000: 96% mana
3.2/5: 64% soul_shard
combat_meditation
4:47.365 aoe J conflagrate Fluffy_Pillow 48833.5/50000: 98% mana
0.5/5: 10% soul_shard
4:48.672 aoe K scouring_tithe Fluffy_Pillow 48987.0/50000: 98% mana
1.0/5: 20% soul_shard
backdraft
4:50.411 default A cataclysm Fluffy_Pillow 48856.5/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
4:52.151 aoe E channel_demonfire Fluffy_Pillow 49226.5/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
4:54.922 default 9 soul_fire Fluffy_Pillow 49862.0/50000: 100% mana
2.0/5: 40% soul_shard
backdraft
4:58.400 aoe H havoc enemy2 49002.5/50000: 98% mana
3.3/5: 66% soul_shard
4:59.707 havoc N conflagrate Fluffy_Pillow 48656.0/50000: 97% mana
3.4/5: 68% soul_shard
5:01.013 havoc R chaos_bolt Fluffy_Pillow 48809.0/50000: 98% mana
4.6/5: 92% soul_shard
backdraft
5:02.841 havoc N conflagrate Fluffy_Pillow 49723.0/50000: 99% mana
2.9/5: 58% soul_shard
5:04.146 havoc R chaos_bolt Fluffy_Pillow 49875.5/50000: 100% mana
3.9/5: 78% soul_shard
backdraft
5:05.975 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.2/5: 44% soul_shard
5:08.583 havoc P scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
5:10.323 havoc Q immolate Fluffy_Pillow 49002.0/50000: 98% mana
0.6/5: 12% soul_shard
5:11.630 aoe F immolate enemy2 48905.5/50000: 98% mana
0.8/5: 16% soul_shard
5:12.935 aoe F immolate enemy3 48808.0/50000: 98% mana
0.9/5: 18% soul_shard
5:14.242 aoe E channel_demonfire Fluffy_Pillow 48711.5/50000: 97% mana
1.0/5: 20% soul_shard
5:17.116 aoe J conflagrate Fluffy_Pillow 49398.5/50000: 99% mana
1.3/5: 26% soul_shard
5:18.422 aoe L incinerate Fluffy_Pillow 49551.5/50000: 99% mana
2.0/5: 40% soul_shard
backdraft
5:19.641 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.3/5: 46% soul_shard
5:21.041 aoe I rain_of_fire Fluffy_Pillow 49202.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
5:22.347 default A cataclysm Fluffy_Pillow 49855.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Kyrian_Pelagos"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=kyrian
soulbind=328266/infernal_brand:6/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Necrolord_Emeni : 9842 dps, 5418 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9842.1 9842.1 16.3 / 0.166% 773.2 / 7.9% 20.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
420.7 417.3 Mana 0.00% 38.0 100.0% 100%
Talents
Necrolord

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necrolord_Emeni 9842
Cataclysm 786 8.0% 9.7 32.43sec 24317 14313 Direct 29.0 6808 13631 8106 19.0%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.66 28.97 0.00 0.00 1.6991 0.0000 234841.28 234841.28 0.00% 14312.61 14312.61
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.99% 23.46 15 33 6808.42 6142 8348 6807.31 6504 7192 159752 159752 0.00%
crit 19.01% 5.51 0 13 13631.08 12283 16693 13604.57 0 16370 75090 75090 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.71
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1042) 0.0% (10.6%) 12.1 25.87sec 25837 9616

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.05 0.00 179.97 0.00 2.6869 0.1630 0.00 0.00 0.00% 9616.11 9616.11

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.05
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1042 10.6% 0.0 0.00sec 0 0 Direct 539.9 484 965 577 19.4%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 539.92 0.00 0.00 0.0000 0.0000 311408.23 311408.23 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 435.45 317 564 483.53 263 1122 483.79 454 512 210536 210536 0.00%
crit 19.35% 104.48 59 154 965.10 525 2245 965.88 846 1129 100872 100872 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1199 (1591) 12.2% (16.2%) 19.0 15.25sec 24949 12393 Direct 37.8 (74.9) 0 9461 9461 100.0% (59.8%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.04 37.83 0.00 0.00 2.0132 0.0000 357945.11 357945.11 0.00% 12392.80 12392.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 37.83 28 52 9460.88 5962 14075 9461.97 9166 9773 357945 357945 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [R]:19.14
  • if_expr:cast_time<havoc_remains
    Internal Combustion 392 4.0% 37.0 15.22sec 3158 0 Direct 37.0 2652 5353 3159 18.8%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.04 37.03 0.00 0.00 0.0000 0.0000 116959.47 116959.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.25% 30.09 18 45 2651.55 1 4271 2652.83 2411 2899 79760 79760 0.00%
crit 18.75% 6.94 1 14 5353.16 2 8543 5348.02 2554 7080 37199 37199 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 823 8.4% 36.7 7.98sec 6710 5371 Direct 55.0 3741 7536 4470 19.2%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.67 55.03 0.00 0.00 1.2492 0.0000 246038.95 246038.95 0.00% 5371.44 5371.44
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 44.45 29 58 3741.21 2047 5796 3741.56 3462 4027 166302 166302 0.00%
crit 19.22% 10.58 4 22 7536.28 4095 11596 7536.57 5641 9234 79737 79737 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:18.30
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.37
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Decimating Bolt 0 (187) 0.0% (1.9%) 6.4 49.36sec 8779 4186

Stats Details: Decimating Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.38 0.00 0.00 0.00 2.0970 0.0000 0.00 0.00 0.00% 4186.49 4186.49

Action Details: Decimating Bolt

  • id:325289
  • school:shadow
  • range:40.0
  • travel_speed:25.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:325289
  • name:Decimating Bolt
  • school:shadow
  • tooltip:
  • description:Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.

Action Priority List

    aoe
    [J]:2.99
  • if_expr:(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
    havoc
    [P]:3.45
  • if_expr:cast_time<havoc_remains&soulbind.lead_by_example.enabled
    Decimating Bolt (_tick_t) 187 1.9% 0.0 0.00sec 0 0 Direct 39.0 1210 2417 1433 18.5%

Stats Details: Decimating Bolt Tick T

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 39.04 0.00 0.00 0.0000 0.0000 55985.88 55985.88 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.49% 31.81 20 43 1209.79 592 1925 1208.64 1084 1367 38505 38505 0.00%
crit 18.51% 7.23 1 16 2416.69 1185 3847 2415.56 1193 3546 17481 17481 0.00%

Action Details: Decimating Bolt Tick T

  • id:327059
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:327059
  • name:Decimating Bolt
  • school:shadow
  • tooltip:
  • description:{$@spelldesc325289=Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.}
Immolate 1643 16.7% 25.9 11.05sec 18996 15075 Direct 32.3 1546 3084 1853 19.9%
Periodic 347.6 1041 2084 1241 19.1% 96.2%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.85 32.29 347.62 347.62 1.2601 2.4839 491128.43 491128.43 0.00% 548.11 15075.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.08% 25.86 16 37 1545.62 819 2318 1545.97 1413 1698 39972 39972 0.00%
crit 19.92% 6.43 0 15 3083.79 1640 4633 3075.24 0 3932 19832 19832 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.86% 281.08 210 356 1041.17 4 1449 1041.32 1022 1072 292670 292670 0.00%
crit 19.14% 66.54 36 97 2083.60 1 2899 2084.19 1961 2194 138655 138655 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:18.11
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [Q]:7.85
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 936 9.5% 43.3 6.42sec 6469 4483 Direct 54.1 (54.1) 4336 8753 5180 19.0% (19.0%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.30 54.10 0.00 0.00 1.4431 0.0000 280123.87 280123.87 0.00% 4482.99 4482.99
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.99% 43.82 27 64 4336.39 1375 10170 4343.71 3753 4955 190015 190015 0.00%
crit 19.01% 10.29 2 21 8752.83 2782 20174 8786.06 5105 14806 90109 90109 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:32.34
    havoc
    [S]:11.19
  • if_expr:cast_time<havoc_remains
Rain of Fire 991 10.1% 18.5 15.60sec 15979 12869 Periodic 439.3 564 1130 673 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.52 0.00 0.00 439.29 1.2417 0.0000 295862.09 295862.09 0.00% 12869.16 12869.16
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.69% 354.46 249 489 564.25 507 689 564.18 555 575 200011 200011 0.00%
crit 19.31% 84.83 48 132 1129.76 1013 1378 1129.68 1102 1158 95851 95851 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:6.39
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:12.11
Soul Fire 494 5.0% 5.5 49.50sec 26628 7657 Direct 7.8 15962 31357 18882 18.9%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.54 7.82 0.00 0.00 3.4775 0.0000 147626.23 147626.23 0.00% 7657.36 7657.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.08% 6.34 2 11 15962.22 8604 21172 15998.34 12233 19080 101224 101224 0.00%
crit 18.92% 1.48 0 5 31357.26 17227 42337 24996.72 0 42337 46402 46402 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.28
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.36
  • if_expr:cast_time<havoc_remains
Summon Infernal 81 0.8% 2.0 180.43sec 11992 10373 Direct 6.0 3348 6696 4003 19.4%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1564 0.0000 23983.36 23983.36 0.00% 10373.43 10373.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 4.84 1 6 3348.13 3348 3348 3348.13 3348 3348 16194 16194 0.00%
crit 19.39% 1.16 0 5 6696.27 6696 6696 4778.46 0 6696 7789 7789 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3651 / 742
Immolation 3376 6.9% 39.0 5.49sec 5194 0 Direct 117.0 1450 2900 1731 19.4%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 202560.09 202560.09 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.62% 94.33 80 107 1450.44 1395 1604 1450.39 1432 1466 136817 136817 0.00%
crit 19.38% 22.67 10 37 2899.72 2790 3208 2900.12 2812 3008 65743 65743 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 275 0.6% 41.0 5.25sec 403 280 Direct 41.0 338 677 403 19.1%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 16506.08 23577.28 29.99% 280.22 280.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.87% 33.16 26 40 337.67 326 374 337.66 332 343 11195 15991 29.99%
crit 19.13% 7.84 1 15 676.90 651 749 677.00 651 749 5311 7586 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 525 / 525
Firebolt 525 5.3% 93.0 3.22sec 1687 1159 Direct 92.3 1426 2853 1700 19.2%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.02 92.30 0.00 0.00 1.4558 0.0000 156896.48 156896.48 0.00% 1158.57 1158.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.83% 74.61 53 95 1426.48 1395 1604 1426.52 1414 1441 106436 106436 0.00%
crit 19.17% 17.69 7 32 2852.71 2790 3208 2852.28 2790 3015 50461 50461 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.47
Simple Action Stats Execute Interval
Necrolord_Emeni
Havoc 9.6 32.19sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.62 0.00 0.00 0.00 1.2441 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.63
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.7 0.0 8.0sec 8.0sec 4.2sec 51.16% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 23.3s
  • trigger_min/max:1.9s / 23.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:51.16%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.56% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.56%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Decimating Bolt 6.3 3.4 49.3sec 30.1sec 15.1sec 32.05% 0.00% 3.4 (10.3) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_decimating_bolt
  • max_stacks:3
  • base duration:45.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:47.2s / 57.4s
  • trigger_min/max:0.0s / 57.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 27.7s

Stack Uptimes

  • decimating_bolt_1:8.37%
  • decimating_bolt_2:9.17%
  • decimating_bolt_3:14.52%

Spelldata

  • id:325299
  • name:Decimating Bolt
  • tooltip:Damage of {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044&!s137046[Demonbolt][Shadow Bolt] increased by $w2%.
  • description:{$@spelldesc325289=Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.}
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Lead by Example 6.4 0.0 49.3sec 49.3sec 7.4sec 15.81% 0.00% 0.0 (0.0) 6.2

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_lead_by_example
  • max_stacks:1
  • base duration:7.50
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:47.2s / 57.4s
  • trigger_min/max:47.2s / 57.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.5s

Stack Uptimes

  • lead_by_example_1:15.81%

Spelldata

  • id:342181
  • name:Lead by Example
  • tooltip:$pri increased by $w1%.
  • description:{$@spelldesc342156=$?a137005[Abomination Limb]?a212611[Fodder to the Flame]?a137009[Adaptive Swarm]?a137014[Death Chakram]?a137018[Deathborne]?a137022[Bonedust Brew]?a137026[Vanquisher's Hammer]?a137030[Unholy Nova]?a137034[Serrated Bone Spike]?a137038[Primordial Wave]?a137042[Decimating Bolt]?a137047[Conqueror's Banner][Activating your Necrolord class ability] increases your $pri by {$342181s2=5}% and nearby allies' primary stat by {$342181s1=2}% for ${{$s3=10}*$<mod>}.1 sec. You gain {$342181s2=5}% additional $pri for each ally affected, up to ${({$342181s3=3}*{$342181s2=5})}%.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 182.3s
  • trigger_min/max:180.0s / 182.3s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 182.3s
  • trigger_min/max:180.0s / 182.3s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 8.81% 5.95% 12.43% 0.7s 0.0s 5.5s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necrolord_Emeni
soul_fire Soul Shard 6.55 7.24 7.80% 1.11 0.64 8.17%
immolate Soul Shard 347.65 33.19 35.74% 0.10 1.57 4.52%
incinerate Soul Shard 43.31 10.88 11.72% 0.25 0.01 0.06%
conflagrate Soul Shard 36.67 27.51 29.62% 0.75 0.00 0.00%
mana_regen Mana 682.68 124796.10 100.00% 182.80 24438.09 16.38%
immolate_crits Soul Shard 33.37 3.19 3.44% 0.10 0.14 4.33%
incinerate_crits Soul Shard 10.33 1.03 1.11% 0.10 0.00 0.18%
infernal Soul Shard 120.00 9.82 10.58% 0.08 2.18 18.13%
pet - imp
energy_regen Energy 360.01 3550.34 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 417.27 420.72 24441.7 48967.9 47135.0 50000.0
Soul Shard 4.0 0.31 0.31 4.6 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
Necrolord_Emeni
cataclysm Mana 9.7 4833.1 500.0 500.4 48.6
channel_demonfire Mana 12.1 9041.0 750.0 750.1 34.4
chaos_bolt Soul Shard 19.0 38.1 2.0 2.0 12476.0
conflagrate Mana 36.7 18333.1 500.0 500.0 13.4
decimating_bolt Mana 6.4 12736.3 2000.0 1997.0 4.4
havoc Mana 9.6 9627.1 1000.0 1000.3 0.0
immolate Mana 25.9 19387.7 750.0 749.9 25.3
incinerate Mana 43.3 43313.6 1000.0 1000.3 6.5
rain_of_fire Soul Shard 18.5 55.5 3.0 3.0 5328.8
soul_fire Mana 6.6 6550.7 1000.0 1181.6 22.5
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 93.0 3720.9 40.0 40.0 42.2

Statistics & Data Analysis

Fight Length
Necrolord_Emeni Fight Length
Count 625
Mean 299.05
Minimum 240.24
Maximum 359.94
Spread ( max - min ) 119.70
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Necrolord_Emeni Damage Per Second
Count 625
Mean 9842.06
Minimum 9345.22
Maximum 10459.78
Spread ( max - min ) 1114.56
Range [ ( max - min ) / 2 * 100% ] 5.66%
Standard Deviation 207.7993
5th Percentile 9525.31
95th Percentile 10190.38
( 95th Percentile - 5th Percentile ) 665.06
Mean Distribution
Standard Deviation 8.3120
95.00% Confidence Interval ( 9825.76 - 9858.35 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1713
0.1 Scale Factor Error with Delta=300 369
0.05 Scale Factor Error with Delta=300 1475
0.01 Scale Factor Error with Delta=300 36862
Priority Target DPS
Necrolord_Emeni Priority Target Damage Per Second
Count 625
Mean 5417.97
Minimum 5104.25
Maximum 5882.99
Spread ( max - min ) 778.74
Range [ ( max - min ) / 2 * 100% ] 7.19%
Standard Deviation 128.3896
5th Percentile 5216.62
95th Percentile 5626.11
( 95th Percentile - 5th Percentile ) 409.49
Mean Distribution
Standard Deviation 5.1356
95.00% Confidence Interval ( 5407.90 - 5428.03 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2158
0.1 Scale Factor Error with Delta=300 141
0.05 Scale Factor Error with Delta=300 563
0.01 Scale Factor Error with Delta=300 14072
DPS(e)
Necrolord_Emeni Damage Per Second (Effective)
Count 625
Mean 9842.06
Minimum 9345.22
Maximum 10459.78
Spread ( max - min ) 1114.56
Range [ ( max - min ) / 2 * 100% ] 5.66%
Damage
Necrolord_Emeni Damage
Count 625
Mean 2561902.91
Minimum 2046191.87
Maximum 3070032.37
Spread ( max - min ) 1023840.51
Range [ ( max - min ) / 2 * 100% ] 19.98%
DTPS
Necrolord_Emeni Damage Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necrolord_Emeni Healing Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necrolord_Emeni Healing Per Second (Effective)
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necrolord_Emeni Heal
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necrolord_Emeni Healing Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necrolord_Emeni Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Necrolord_EmeniTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necrolord_Emeni Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.28 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.71 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 6.39 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.05 channel_demonfire,if=dot.immolate.remains>cast_time
F 18.11 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.63 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 12.11 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
J 2.99 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 18.30 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 32.34 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.37 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.36 soul_fire,if=cast_time<havoc_remains
P 3.45 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
Q 7.85 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
R 19.14 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
S 11.19 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHPRNRNQRNDFELDFFKLDKLKLADLEHNRSRONFFIJEKLKAILLHNRSSQNSEFILKILLLA9HNPRNRSQEFFIKLKLILALHNRSSNQSEI9FIJKLKAHRNRSSQEKILLFKLMLDFKAHROQPSDEDKFLKILKLLLAHNRRQNRELFF9FIJKLKAHRSNRSNQEFILFKLLLKILAHSNOPRNEILFLKIFFLLKA

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.740 aoe E channel_demonfire Fluffy_Pillow 49370.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:04.019 cds M summon_infernal Fluffy_Pillow 49759.5/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust
0:05.025 aoe H havoc enemy2 49262.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust
0:06.030 havoc P decimating_bolt Fluffy_Pillow 48765.0/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust
0:07.705 havoc R chaos_bolt Fluffy_Pillow 47602.5/50000: 95% mana
5.0/5: 100% soul_shard
bloodlust, lead_by_example
0:09.714 havoc N conflagrate Fluffy_Pillow 48607.0/50000: 97% mana
3.0/5: 60% soul_shard
bloodlust, decimating_bolt(3), lead_by_example
0:10.721 havoc R chaos_bolt Fluffy_Pillow 48610.5/50000: 97% mana
4.4/5: 88% soul_shard
bloodlust, backdraft, decimating_bolt(3), lead_by_example
0:12.128 havoc N conflagrate Fluffy_Pillow 49314.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust, decimating_bolt(3), lead_by_example
0:13.136 havoc Q immolate Fluffy_Pillow 49318.0/50000: 99% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, decimating_bolt(3), lead_by_example
0:14.142 havoc R chaos_bolt Fluffy_Pillow 49071.0/50000: 98% mana
4.7/5: 94% soul_shard
bloodlust, backdraft, decimating_bolt(3), lead_by_example
0:15.548 havoc N conflagrate Fluffy_Pillow 49774.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, decimating_bolt(3)
0:16.555 aoe D rain_of_fire Fluffy_Pillow 49777.5/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, decimating_bolt(3)
0:17.560 aoe F immolate enemy3 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
bloodlust, backdraft, decimating_bolt(3)
0:18.566 aoe E channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
2.3/5: 46% soul_shard
bloodlust, backdraft, decimating_bolt(3)
0:20.798 aoe L incinerate Fluffy_Pillow 49618.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust, backdraft, decimating_bolt(3)
0:21.738 aoe D rain_of_fire Fluffy_Pillow 49002.5/50000: 98% mana
3.5/5: 70% soul_shard
bloodlust, decimating_bolt(2)
0:22.743 aoe F immolate enemy2 49505.0/50000: 99% mana
0.9/5: 18% soul_shard
bloodlust, decimating_bolt(2)
0:23.749 aoe F immolate Fluffy_Pillow 49252.0/50000: 99% mana
1.2/5: 24% soul_shard
bloodlust, decimating_bolt(2)
0:24.754 aoe K conflagrate Fluffy_Pillow 49004.5/50000: 98% mana
1.7/5: 34% soul_shard
bloodlust, decimating_bolt(2)
0:25.761 aoe L incinerate Fluffy_Pillow 49008.0/50000: 98% mana
2.5/5: 50% soul_shard
bloodlust, backdraft, decimating_bolt(2)
0:26.701 aoe D rain_of_fire Fluffy_Pillow 48478.0/50000: 97% mana
3.1/5: 62% soul_shard
bloodlust, decimating_bolt
0:27.706 aoe K conflagrate Fluffy_Pillow 48980.5/50000: 98% mana
0.3/5: 6% soul_shard
bloodlust, decimating_bolt
0:28.712 aoe L incinerate Fluffy_Pillow 48983.5/50000: 98% mana
1.3/5: 26% soul_shard
bloodlust, backdraft, decimating_bolt
0:29.651 aoe K conflagrate Fluffy_Pillow 48453.0/50000: 97% mana
1.7/5: 34% soul_shard
bloodlust
0:30.679 aoe L incinerate Fluffy_Pillow 48467.0/50000: 97% mana
2.7/5: 54% soul_shard
bloodlust, backdraft
0:31.618 default A cataclysm Fluffy_Pillow 47936.5/50000: 96% mana
3.1/5: 62% soul_shard
bloodlust
0:33.076 aoe D rain_of_fire Fluffy_Pillow 48165.5/50000: 96% mana
3.7/5: 74% soul_shard
bloodlust
0:34.082 aoe L incinerate Fluffy_Pillow 48668.5/50000: 97% mana
1.1/5: 22% soul_shard
bloodlust
0:35.422 aoe E channel_demonfire Fluffy_Pillow 48338.5/50000: 97% mana
1.4/5: 28% soul_shard
bloodlust
0:37.723 aoe H havoc enemy2 48739.0/50000: 97% mana
1.7/5: 34% soul_shard
bloodlust
0:38.729 havoc N conflagrate Fluffy_Pillow 48242.0/50000: 96% mana
2.1/5: 42% soul_shard
bloodlust
0:39.735 havoc R chaos_bolt Fluffy_Pillow 48245.0/50000: 96% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:41.142 havoc S incinerate Fluffy_Pillow 48948.5/50000: 98% mana
1.5/5: 30% soul_shard
0:42.883 havoc R chaos_bolt Fluffy_Pillow 48819.0/50000: 98% mana
2.2/5: 44% soul_shard
0:45.492 havoc O soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
0:48.971 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
2.8/5: 56% soul_shard
0:50.276 aoe F immolate Fluffy_Pillow 49155.5/50000: 98% mana
3.9/5: 78% soul_shard
backdraft
0:51.583 aoe F immolate enemy3 49059.0/50000: 98% mana
3.9/5: 78% soul_shard
backdraft
0:52.889 aoe I rain_of_fire Fluffy_Pillow 48962.0/50000: 98% mana
4.0/5: 80% soul_shard
backdraft
0:54.196 aoe J decimating_bolt Fluffy_Pillow 49615.5/50000: 99% mana
1.3/5: 26% soul_shard
backdraft
0:56.371 aoe E channel_demonfire Fluffy_Pillow 48002.0/50000: 96% mana
1.6/5: 32% soul_shard
backdraft, lead_by_example
0:59.226 aoe K conflagrate Fluffy_Pillow 48679.5/50000: 97% mana
1.9/5: 38% soul_shard
decimating_bolt(3), lead_by_example
1:00.532 aoe L incinerate Fluffy_Pillow 48832.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft, decimating_bolt(3), lead_by_example
1:01.752 aoe K conflagrate Fluffy_Pillow 48442.5/50000: 97% mana
2.9/5: 58% soul_shard
decimating_bolt(2), lead_by_example
1:03.056 default A cataclysm Fluffy_Pillow 48594.5/50000: 97% mana
3.5/5: 70% soul_shard
backdraft, decimating_bolt(2), lead_by_example
1:04.812 aoe I rain_of_fire Fluffy_Pillow 48972.5/50000: 98% mana
3.8/5: 76% soul_shard
backdraft, decimating_bolt(2)
1:06.120 aoe L incinerate Fluffy_Pillow 49626.5/50000: 99% mana
0.9/5: 18% soul_shard
backdraft, decimating_bolt(2)
1:07.339 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
decimating_bolt
1:09.081 aoe H havoc enemy2 48873.0/50000: 98% mana
1.9/5: 38% soul_shard
1:10.387 havoc N conflagrate Fluffy_Pillow 48526.0/50000: 97% mana
1.9/5: 38% soul_shard
1:11.693 havoc R chaos_bolt Fluffy_Pillow 48679.0/50000: 97% mana
3.2/5: 64% soul_shard
backdraft
1:13.520 havoc S incinerate Fluffy_Pillow 49592.5/50000: 99% mana
1.3/5: 26% soul_shard
1:15.261 havoc S incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.9/5: 38% soul_shard
1:17.001 havoc Q immolate Fluffy_Pillow 48872.5/50000: 98% mana
2.7/5: 54% soul_shard
1:18.308 havoc N conflagrate Fluffy_Pillow 48776.0/50000: 98% mana
2.8/5: 56% soul_shard
1:19.615 havoc S incinerate Fluffy_Pillow 48929.5/50000: 98% mana
4.0/5: 80% soul_shard
backdraft
1:20.833 aoe E channel_demonfire Fluffy_Pillow 48538.5/50000: 97% mana
4.4/5: 88% soul_shard
1:23.521 aoe F immolate enemy3 49132.5/50000: 98% mana
5.0/5: 100% soul_shard
1:24.827 aoe I rain_of_fire Fluffy_Pillow 49035.5/50000: 98% mana
5.0/5: 100% soul_shard
1:26.134 aoe L incinerate Fluffy_Pillow 49689.0/50000: 99% mana
2.1/5: 42% soul_shard
1:27.875 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.5/5: 50% soul_shard
1:29.182 aoe I rain_of_fire Fluffy_Pillow 49156.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
1:30.488 aoe L incinerate Fluffy_Pillow 49809.0/50000: 100% mana
0.3/5: 6% soul_shard
backdraft
1:31.706 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
0.6/5: 12% soul_shard
1:33.446 aoe L incinerate Fluffy_Pillow 48871.5/50000: 98% mana
1.0/5: 20% soul_shard
1:35.187 default A cataclysm Fluffy_Pillow 48742.0/50000: 97% mana
1.6/5: 32% soul_shard
1:36.927 default 9 soul_fire Fluffy_Pillow 49112.0/50000: 98% mana
1.7/5: 34% soul_shard
1:40.405 aoe H havoc enemy2 49002.5/50000: 98% mana
3.2/5: 64% soul_shard
1:41.712 havoc N conflagrate Fluffy_Pillow 48656.0/50000: 97% mana
3.2/5: 64% soul_shard
1:43.018 havoc P decimating_bolt Fluffy_Pillow 48809.0/50000: 98% mana
4.6/5: 92% soul_shard
backdraft
1:45.194 havoc R chaos_bolt Fluffy_Pillow 47897.0/50000: 96% mana
4.7/5: 94% soul_shard
backdraft, lead_by_example
1:47.024 havoc N conflagrate Fluffy_Pillow 48812.0/50000: 98% mana
3.0/5: 60% soul_shard
decimating_bolt(3), lead_by_example
1:48.329 havoc R chaos_bolt Fluffy_Pillow 48964.5/50000: 98% mana
4.2/5: 84% soul_shard
backdraft, decimating_bolt(3), lead_by_example
1:50.157 havoc S incinerate Fluffy_Pillow 49878.5/50000: 100% mana
2.3/5: 46% soul_shard
decimating_bolt(3), lead_by_example
1:51.897 havoc Q immolate Fluffy_Pillow 49002.0/50000: 98% mana
2.9/5: 58% soul_shard
decimating_bolt(2), lead_by_example
1:53.203 aoe E channel_demonfire Fluffy_Pillow 48905.0/50000: 98% mana
3.3/5: 66% soul_shard
decimating_bolt(2)
1:55.999 aoe F immolate enemy3 49553.0/50000: 99% mana
3.6/5: 72% soul_shard
decimating_bolt(2)
1:57.306 aoe F immolate enemy2 49252.5/50000: 99% mana
3.6/5: 72% soul_shard
decimating_bolt(2)
1:58.613 aoe I rain_of_fire Fluffy_Pillow 49156.0/50000: 98% mana
3.8/5: 76% soul_shard
decimating_bolt(2)
1:59.919 aoe K conflagrate Fluffy_Pillow 49809.0/50000: 100% mana
0.8/5: 16% soul_shard
decimating_bolt(2)
2:01.226 aoe L incinerate Fluffy_Pillow 49962.5/50000: 100% mana
1.6/5: 32% soul_shard
backdraft, decimating_bolt(2)
2:02.446 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.8/5: 36% soul_shard
decimating_bolt
2:03.752 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft, decimating_bolt
2:04.973 aoe I rain_of_fire Fluffy_Pillow 48766.0/50000: 98% mana
3.0/5: 60% soul_shard
2:06.279 aoe L incinerate Fluffy_Pillow 49419.0/50000: 99% mana
0.3/5: 6% soul_shard
2:08.021 default A cataclysm Fluffy_Pillow 49003.0/50000: 98% mana
0.7/5: 14% soul_shard
2:09.762 aoe L incinerate Fluffy_Pillow 49373.5/50000: 99% mana
0.9/5: 18% soul_shard
2:11.503 aoe H havoc enemy2 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
2:12.809 havoc N conflagrate Fluffy_Pillow 48655.5/50000: 97% mana
1.4/5: 28% soul_shard
2:14.114 havoc R chaos_bolt Fluffy_Pillow 48808.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:15.943 havoc S incinerate Fluffy_Pillow 49722.5/50000: 99% mana
0.8/5: 16% soul_shard
2:17.684 havoc S incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
2:19.426 havoc N conflagrate Fluffy_Pillow 48873.5/50000: 98% mana
2.1/5: 42% soul_shard
2:20.732 havoc Q immolate Fluffy_Pillow 49026.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
2:22.038 havoc S incinerate Fluffy_Pillow 48929.5/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
2:23.258 aoe E channel_demonfire Fluffy_Pillow 48539.5/50000: 97% mana
3.9/5: 78% soul_shard
2:26.117 aoe I rain_of_fire Fluffy_Pillow 49219.0/50000: 98% mana
4.4/5: 88% soul_shard
2:27.424 default 9 soul_fire Fluffy_Pillow 49872.5/50000: 100% mana
1.7/5: 34% soul_shard
2:30.901 aoe F immolate enemy3 49002.0/50000: 98% mana
3.0/5: 60% soul_shard
2:32.207 aoe I rain_of_fire Fluffy_Pillow 48905.0/50000: 98% mana
3.1/5: 62% soul_shard
2:33.513 aoe J decimating_bolt Fluffy_Pillow 49558.0/50000: 99% mana
0.3/5: 6% soul_shard
2:35.688 aoe K conflagrate Fluffy_Pillow 48002.0/50000: 96% mana
0.7/5: 14% soul_shard
lead_by_example
2:36.995 aoe L incinerate Fluffy_Pillow 48155.5/50000: 96% mana
1.3/5: 26% soul_shard
backdraft, lead_by_example
2:38.213 aoe K conflagrate Fluffy_Pillow 47764.5/50000: 96% mana
1.8/5: 36% soul_shard
decimating_bolt(2), lead_by_example
2:39.520 default A cataclysm Fluffy_Pillow 47918.0/50000: 96% mana
2.4/5: 48% soul_shard
backdraft, decimating_bolt(2), lead_by_example
2:41.498 aoe H havoc enemy2 48407.0/50000: 97% mana
2.7/5: 54% soul_shard
backdraft, decimating_bolt(2), lead_by_example
2:42.811 havoc R chaos_bolt Fluffy_Pillow 48063.5/50000: 96% mana
2.9/5: 58% soul_shard
backdraft, decimating_bolt(2), lead_by_example
2:44.639 havoc N conflagrate Fluffy_Pillow 48977.5/50000: 98% mana
1.1/5: 22% soul_shard
decimating_bolt(2)
2:45.965 havoc R chaos_bolt Fluffy_Pillow 49140.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft, decimating_bolt(2)
2:47.792 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
decimating_bolt(2)
2:49.532 havoc S incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
decimating_bolt
2:51.272 havoc Q immolate Fluffy_Pillow 48872.0/50000: 98% mana
1.7/5: 34% soul_shard
2:52.578 aoe E channel_demonfire Fluffy_Pillow 48775.0/50000: 98% mana
1.8/5: 36% soul_shard
2:55.427 aoe K conflagrate Fluffy_Pillow 49449.5/50000: 99% mana
2.2/5: 44% soul_shard
2:56.734 aoe I rain_of_fire Fluffy_Pillow 49603.0/50000: 99% mana
3.0/5: 60% soul_shard
backdraft
2:58.041 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.1/5: 2% soul_shard
backdraft
2:59.259 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
0.5/5: 10% soul_shard
3:01.000 aoe F immolate enemy3 48872.0/50000: 98% mana
1.0/5: 20% soul_shard
3:02.308 aoe K conflagrate Fluffy_Pillow 48776.0/50000: 98% mana
1.1/5: 22% soul_shard
3:03.614 aoe L incinerate Fluffy_Pillow 48929.0/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
3:04.833 cds M summon_infernal Fluffy_Pillow 48538.5/50000: 97% mana
2.2/5: 44% soul_shard
3:06.138 aoe L incinerate Fluffy_Pillow 48191.0/50000: 96% mana
2.7/5: 54% soul_shard
3:07.879 aoe D rain_of_fire Fluffy_Pillow 48061.5/50000: 96% mana
3.5/5: 70% soul_shard
3:09.185 aoe F immolate enemy2 48714.5/50000: 97% mana
1.0/5: 20% soul_shard
3:10.491 aoe K conflagrate Fluffy_Pillow 48617.5/50000: 97% mana
1.5/5: 30% soul_shard
3:11.912 default A cataclysm Fluffy_Pillow 48828.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
3:13.652 aoe H havoc enemy2 49198.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
3:14.958 havoc R chaos_bolt Fluffy_Pillow 48851.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
3:16.786 havoc O soul_fire Fluffy_Pillow 49765.0/50000: 100% mana
2.0/5: 40% soul_shard
3:20.263 havoc Q immolate Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
3:21.570 havoc P decimating_bolt Fluffy_Pillow 48905.5/50000: 98% mana
5.0/5: 100% soul_shard
3:23.747 havoc S incinerate Fluffy_Pillow 47994.0/50000: 96% mana
5.0/5: 100% soul_shard
lead_by_example
3:25.489 aoe D rain_of_fire Fluffy_Pillow 47865.0/50000: 96% mana
5.0/5: 100% soul_shard
decimating_bolt(2), lead_by_example
3:26.795 aoe E channel_demonfire Fluffy_Pillow 48518.0/50000: 97% mana
2.5/5: 50% soul_shard
decimating_bolt(2), lead_by_example
3:29.630 aoe D rain_of_fire Fluffy_Pillow 49185.5/50000: 98% mana
3.4/5: 68% soul_shard
decimating_bolt(2), lead_by_example
3:30.936 aoe K conflagrate Fluffy_Pillow 49838.5/50000: 100% mana
0.8/5: 16% soul_shard
decimating_bolt(2), lead_by_example
3:32.242 aoe F immolate enemy3 49991.5/50000: 100% mana
1.7/5: 34% soul_shard
backdraft, decimating_bolt(2)
3:33.548 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
2.1/5: 42% soul_shard
backdraft, decimating_bolt(2)
3:34.766 aoe K conflagrate Fluffy_Pillow 48861.0/50000: 98% mana
2.7/5: 54% soul_shard
decimating_bolt
3:36.073 aoe I rain_of_fire Fluffy_Pillow 49014.5/50000: 98% mana
3.4/5: 68% soul_shard
backdraft, decimating_bolt
3:37.380 aoe L incinerate Fluffy_Pillow 49668.0/50000: 99% mana
0.6/5: 12% soul_shard
backdraft, decimating_bolt
3:38.599 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
3:39.905 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
1.6/5: 32% soul_shard
backdraft
3:41.125 aoe L incinerate Fluffy_Pillow 48765.0/50000: 98% mana
1.9/5: 38% soul_shard
3:42.865 aoe L incinerate Fluffy_Pillow 48635.0/50000: 97% mana
2.4/5: 48% soul_shard
3:44.605 default A cataclysm Fluffy_Pillow 48505.0/50000: 97% mana
2.8/5: 56% soul_shard
3:46.344 aoe H havoc enemy2 48874.5/50000: 98% mana
3.1/5: 62% soul_shard
3:47.650 havoc N conflagrate Fluffy_Pillow 48527.5/50000: 97% mana
3.2/5: 64% soul_shard
3:48.957 havoc R chaos_bolt Fluffy_Pillow 48681.0/50000: 97% mana
4.4/5: 88% soul_shard
backdraft
3:50.785 havoc R chaos_bolt Fluffy_Pillow 49595.0/50000: 99% mana
2.5/5: 50% soul_shard
3:53.395 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
3:54.703 havoc N conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
1.2/5: 24% soul_shard
3:56.009 havoc R chaos_bolt Fluffy_Pillow 49406.0/50000: 99% mana
2.2/5: 44% soul_shard
backdraft
3:57.836 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
4:00.760 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
4:02.500 aoe F immolate Fluffy_Pillow 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
4:03.808 aoe F immolate enemy2 48906.0/50000: 98% mana
1.3/5: 26% soul_shard
4:05.115 default 9 soul_fire Fluffy_Pillow 48809.5/50000: 98% mana
1.7/5: 34% soul_shard
4:08.736 aoe F immolate enemy3 49002.0/50000: 98% mana
3.1/5: 62% soul_shard
4:10.042 aoe I rain_of_fire Fluffy_Pillow 48905.0/50000: 98% mana
3.5/5: 70% soul_shard
4:11.349 aoe J decimating_bolt Fluffy_Pillow 49558.5/50000: 99% mana
0.5/5: 10% soul_shard
4:13.524 aoe K conflagrate Fluffy_Pillow 48002.0/50000: 96% mana
0.8/5: 16% soul_shard
lead_by_example
4:14.829 aoe L incinerate Fluffy_Pillow 48154.5/50000: 96% mana
1.3/5: 26% soul_shard
backdraft, lead_by_example
4:16.047 aoe K conflagrate Fluffy_Pillow 47763.5/50000: 96% mana
1.8/5: 36% soul_shard
decimating_bolt(2), lead_by_example
4:17.354 default A cataclysm Fluffy_Pillow 47917.0/50000: 96% mana
2.3/5: 46% soul_shard
backdraft, decimating_bolt(2), lead_by_example
4:19.095 aoe H havoc enemy2 48287.5/50000: 97% mana
2.6/5: 52% soul_shard
backdraft, decimating_bolt(2), lead_by_example
4:20.402 havoc R chaos_bolt Fluffy_Pillow 47941.0/50000: 96% mana
2.8/5: 56% soul_shard
backdraft, decimating_bolt(2), lead_by_example
4:22.230 havoc S incinerate Fluffy_Pillow 48855.0/50000: 98% mana
0.9/5: 18% soul_shard
decimating_bolt(2)
4:23.971 havoc N conflagrate Fluffy_Pillow 48725.5/50000: 97% mana
1.6/5: 32% soul_shard
decimating_bolt
4:25.276 havoc R chaos_bolt Fluffy_Pillow 48878.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft, decimating_bolt
4:27.103 havoc S incinerate Fluffy_Pillow 49791.5/50000: 100% mana
1.0/5: 20% soul_shard
decimating_bolt
4:28.843 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.7/5: 34% soul_shard
4:30.149 havoc Q immolate Fluffy_Pillow 49155.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
4:31.454 aoe E channel_demonfire Fluffy_Pillow 49057.5/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
4:34.376 aoe F immolate enemy2 49768.5/50000: 100% mana
3.4/5: 68% soul_shard
backdraft
4:35.682 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.4/5: 68% soul_shard
backdraft
4:36.987 aoe L incinerate Fluffy_Pillow 49904.5/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
4:38.207 aoe F immolate enemy3 49002.5/50000: 98% mana
0.8/5: 16% soul_shard
4:39.514 aoe K conflagrate Fluffy_Pillow 48906.0/50000: 98% mana
1.1/5: 22% soul_shard
4:40.820 aoe L incinerate Fluffy_Pillow 49059.0/50000: 98% mana
1.6/5: 32% soul_shard
backdraft
4:42.040 aoe L incinerate Fluffy_Pillow 48669.0/50000: 97% mana
2.1/5: 42% soul_shard
4:43.783 aoe L incinerate Fluffy_Pillow 48540.5/50000: 97% mana
2.5/5: 50% soul_shard
4:45.523 aoe K conflagrate Fluffy_Pillow 48410.5/50000: 97% mana
2.8/5: 56% soul_shard
4:47.050 aoe I rain_of_fire Fluffy_Pillow 48674.0/50000: 97% mana
3.6/5: 72% soul_shard
backdraft
4:48.356 aoe L incinerate Fluffy_Pillow 49327.0/50000: 99% mana
0.6/5: 12% soul_shard
backdraft
4:49.576 default A cataclysm Fluffy_Pillow 48937.0/50000: 98% mana
1.1/5: 22% soul_shard
4:51.318 aoe H havoc enemy2 49308.0/50000: 99% mana
1.3/5: 26% soul_shard
4:52.625 havoc S incinerate Fluffy_Pillow 48961.5/50000: 98% mana
1.4/5: 28% soul_shard
4:54.365 havoc N conflagrate Fluffy_Pillow 48831.5/50000: 98% mana
2.1/5: 42% soul_shard
4:55.702 havoc O soul_fire Fluffy_Pillow 49000.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
4:59.180 havoc P decimating_bolt Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
5:01.355 havoc R chaos_bolt Fluffy_Pillow 48002.0/50000: 96% mana
5.0/5: 100% soul_shard
backdraft, lead_by_example
5:03.183 havoc N conflagrate Fluffy_Pillow 48916.0/50000: 98% mana
3.0/5: 60% soul_shard
decimating_bolt(3), lead_by_example
5:04.488 aoe E channel_demonfire Fluffy_Pillow 49068.5/50000: 98% mana
4.2/5: 84% soul_shard
backdraft, decimating_bolt(3), lead_by_example
5:07.244 aoe I rain_of_fire Fluffy_Pillow 49696.5/50000: 99% mana
4.6/5: 92% soul_shard
backdraft, decimating_bolt(3), lead_by_example
5:08.552 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
backdraft, decimating_bolt(3), lead_by_example
5:09.773 aoe F immolate enemy3 49003.0/50000: 98% mana
2.1/5: 42% soul_shard
decimating_bolt(2)
5:11.078 aoe L incinerate Fluffy_Pillow 48905.5/50000: 98% mana
2.2/5: 44% soul_shard
decimating_bolt(2)
5:12.820 aoe K conflagrate Fluffy_Pillow 48776.5/50000: 98% mana
2.8/5: 56% soul_shard
decimating_bolt
5:14.126 aoe I rain_of_fire Fluffy_Pillow 48929.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft, decimating_bolt
5:15.434 aoe F immolate Fluffy_Pillow 49583.5/50000: 99% mana
0.7/5: 14% soul_shard
backdraft, decimating_bolt
5:16.741 aoe F immolate enemy2 49252.5/50000: 99% mana
0.7/5: 14% soul_shard
backdraft, decimating_bolt
5:18.047 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.1/5: 22% soul_shard
backdraft, decimating_bolt
5:19.266 aoe L incinerate Fluffy_Pillow 48765.0/50000: 98% mana
1.3/5: 26% soul_shard
5:21.005 aoe K conflagrate Fluffy_Pillow 48634.5/50000: 97% mana
1.8/5: 36% soul_shard
5:22.312 default A cataclysm Fluffy_Pillow 48788.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Necrolord_Emeni"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=necrolord
soulbind=342156/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Necrolord_Marileth : 9697 dps, 5398 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9696.5 9696.5 17.7 / 0.182% 821.4 / 8.5% 20.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
406.1 402.5 Mana 0.00% 37.7 100.0% 100%
Talents
Necrolord

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necrolord_Marileth 9697
Cataclysm 774 8.0% 9.6 32.59sec 23984 14117 Direct 28.9 6697 13398 7992 19.4%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.64 28.93 0.00 0.00 1.6990 0.0000 231319.14 231319.14 0.00% 14116.88 14116.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.63% 23.33 14 34 6697.28 6141 7261 6696.63 6498 6914 156244 156244 0.00%
crit 19.37% 5.60 0 12 13398.33 12283 14520 13294.41 0 14442 75075 75075 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.70
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1017) 0.0% (10.5%) 12.1 26.14sec 25190 9353

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.07 0.00 180.15 0.00 2.6933 0.1634 0.00 0.00 0.00% 9352.78 9352.78

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.07
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1017 10.5% 0.0 0.00sec 0 0 Direct 540.5 471 942 562 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 540.45 0.00 0.00 0.0000 0.0000 303927.81 303927.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 435.95 320 575 471.28 263 976 471.59 441 498 205443 205443 0.00%
crit 19.34% 104.50 63 160 942.22 525 1952 943.05 823 1084 98485 98485 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1352 (1819) 13.9% (18.8%) 22.5 13.06sec 24148 12229 Direct 44.7 (89.0) 0 9030 9030 100.0% (59.9%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.47 44.70 0.00 0.00 1.9747 0.0000 403618.88 403618.88 0.00% 12228.70 12228.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 44.70 34 58 9030.00 5864 12241 9029.84 8812 9303 403619 403619 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.60
  • if_expr:cast_time<havoc_remains
    Internal Combustion 466 4.8% 44.3 13.03sec 3141 0 Direct 44.3 2633 5272 3142 19.3%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.26 44.26 0.00 0.00 0.0000 0.0000 139029.48 139029.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 35.72 23 51 2632.54 1 3715 2634.13 2470 2827 94002 94002 0.00%
crit 19.30% 8.54 2 18 5272.13 2 7430 5282.15 4046 6721 45027 45027 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 818 8.4% 36.8 7.96sec 6623 5300 Direct 56.8 3609 7205 4294 19.1%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.85 56.84 0.00 0.00 1.2495 0.0000 244044.99 244044.99 0.00% 5300.49 5300.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.93% 46.00 32 65 3608.66 2047 5042 3608.54 3365 3838 165993 165993 0.00%
crit 19.07% 10.84 2 22 7204.87 4096 10084 7202.15 5657 8959 78052 78052 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:16.90
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.93
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Decimating Bolt 0 (101) 0.0% (1.0%) 5.0 60.43sec 5986 2884

Stats Details: Decimating Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.04 0.00 0.00 0.00 2.0761 0.0000 0.00 0.00 0.00% 2883.51 2883.51

Action Details: Decimating Bolt

  • id:325289
  • school:shadow
  • range:40.0
  • travel_speed:25.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:325289
  • name:Decimating Bolt
  • school:shadow
  • tooltip:
  • description:Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.

Action Priority List

    aoe
    [J]:5.08
  • if_expr:(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
    Decimating Bolt (_tick_t) 101 1.0% 0.0 0.00sec 0 0 Direct 20.1 1260 2519 1505 19.4%

Stats Details: Decimating Bolt Tick T

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 20.06 0.00 0.00 0.0000 0.0000 30170.16 30170.16 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.62% 16.17 8 25 1260.06 901 1674 1257.48 1156 1377 20376 20376 0.00%
crit 19.38% 3.89 0 11 2519.19 1802 3347 2466.80 0 3311 9794 9794 0.00%

Action Details: Decimating Bolt Tick T

  • id:327059
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:327059
  • name:Decimating Bolt
  • school:shadow
  • tooltip:
  • description:{$@spelldesc325289=Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.}
Immolate 1609 16.6% 27.0 10.82sec 17796 14100 Direct 34.6 1536 3082 1839 19.6%
Periodic 345.2 1014 2028 1209 19.2% 95.5%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.02 34.57 345.15 345.15 1.2621 2.4825 480879.97 480879.97 0.00% 539.73 14100.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.38% 27.79 16 40 1535.53 819 2017 1536.07 1415 1670 42670 42670 0.00%
crit 19.62% 6.78 0 17 3082.04 1641 4033 3073.27 0 3804 20903 20903 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.76% 278.76 209 351 1013.90 1 1261 1013.97 987 1036 282626 282626 0.00%
crit 19.24% 66.40 39 97 2028.09 5 2521 2028.55 1925 2135 134681 134681 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:18.34
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.80
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 811 8.4% 40.7 6.58sec 5966 4058 Direct 50.2 (50.2) 4068 8086 4841 19.3% (19.3%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.70 50.18 0.00 0.00 1.4702 0.0000 242790.62 242790.62 0.00% 4057.94 4057.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 40.51 24 62 4067.69 1391 8854 4073.40 3430 4810 164630 164630 0.00%
crit 19.26% 9.67 2 19 8086.31 2785 17637 8108.18 4298 12429 78161 78161 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:31.09
    havoc
    [R]:9.83
  • if_expr:cast_time<havoc_remains
Rain of Fire 865 8.9% 16.5 17.26sec 15646 12503 Periodic 391.2 553 1107 660 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.49 0.00 0.00 391.21 1.2514 0.0000 258078.89 258078.89 0.00% 12503.22 12503.22
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.73% 315.81 215 448 553.00 507 599 553.00 545 562 174644 174644 0.00%
crit 19.27% 75.40 46 117 1106.61 1013 1198 1106.51 1081 1128 83435 83435 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.05
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.44
Soul Fire 510 5.3% 5.5 49.30sec 27458 7896 Direct 7.4 17064 33967 20400 19.8%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.54 7.45 0.00 0.00 3.4775 0.0000 152054.00 152054.00 0.00% 7896.45 7896.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.18% 5.97 2 9 17064.33 8668 21174 17078.93 13267 19888 101928 101928 0.00%
crit 19.82% 1.48 0 5 33966.72 17243 42348 28265.94 0 42347 50126 50126 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.68
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:0.95
  • if_expr:cast_time<havoc_remains
Summon Infernal 82 0.8% 2.0 180.58sec 12075 10445 Direct 6.0 3348 6696 4018 20.2%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24149.43 24149.43 0.00% 10445.25 10445.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.79% 4.79 1 6 3348.13 3348 3348 3348.13 3348 3348 16028 16028 0.00%
crit 20.21% 1.21 0 5 6696.27 6696 6696 5078.45 0 6696 8121 8121 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3827 / 778
Immolation 3562 7.4% 39.0 5.49sec 5481 0 Direct 117.0 1529 3058 1827 19.5%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 213750.18 213750.18 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.53% 94.22 80 108 1529.25 1395 2023 1529.23 1489 1558 144082 144082 0.00%
crit 19.47% 22.78 9 37 3057.95 2790 4046 3057.05 2829 3383 69668 69668 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.5% 41.0 5.25sec 388 270 Direct 41.0 326 651 387 19.1%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15893.20 22701.84 29.99% 269.82 269.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.93% 33.18 25 40 325.55 326 326 325.55 326 326 10802 15430 29.99%
crit 19.07% 7.82 1 16 651.10 651 651 651.10 651 651 5091 7272 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 515 / 515
Firebolt 515 5.3% 93.0 3.22sec 1653 1135 Direct 92.3 1395 2790 1666 19.4%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.02 92.30 0.00 0.00 1.4558 0.0000 153761.98 153761.98 0.00% 1135.44 1135.44
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.59% 74.38 54 96 1395.06 1395 1395 1395.06 1395 1395 103768 103768 0.00%
crit 19.41% 17.92 5 31 2790.11 2790 2790 2790.11 2790 2790 49994 49994 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.47
Simple Action Stats Execute Interval
Necrolord_Marileth
Havoc 9.6 32.38sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.57 0.00 0.00 0.00 1.2438 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.56
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.8 0.0 8.0sec 8.0sec 4.2sec 52.19% 0.00% 0.0 (0.0) 3.8

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 24.6s
  • trigger_min/max:1.9s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 10.0s

Stack Uptimes

  • backdraft_1:52.19%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.56% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.56%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Decimating Bolt 5.0 0.0 60.6sec 60.6sec 10.1sec 16.81% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_decimating_bolt
  • max_stacks:3
  • base duration:45.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:47.2s / 73.5s
  • trigger_min/max:47.2s / 73.5s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 38.3s

Stack Uptimes

  • decimating_bolt_1:6.78%
  • decimating_bolt_2:6.09%
  • decimating_bolt_3:3.94%

Spelldata

  • id:325299
  • name:Decimating Bolt
  • tooltip:Damage of {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044&!s137046[Demonbolt][Shadow Bolt] increased by $w2%.
  • description:{$@spelldesc325289=Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.}
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
infernal - infernal: Embers 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 183.1s
  • trigger_min/max:180.0s / 183.1s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 183.1s
  • trigger_min/max:180.0s / 183.1s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 12.06% 8.60% 14.59% 0.9s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necrolord_Marileth
soul_fire Soul Shard 6.55 7.30 7.79% 1.11 0.20 2.63%
immolate Soul Shard 345.19 33.23 35.49% 0.10 1.28 3.72%
incinerate Soul Shard 40.71 10.09 10.78% 0.25 0.00 0.00%
conflagrate Soul Shard 36.84 28.41 30.34% 0.77 0.00 0.00%
mana_regen Mana 665.01 120399.79 100.00% 181.05 28820.69 19.31%
immolate_crits Soul Shard 33.07 3.19 3.41% 0.10 0.12 3.53%
incinerate_crits Soul Shard 9.65 0.97 1.03% 0.10 0.00 0.02%
infernal Soul Shard 120.00 10.46 11.17% 0.09 1.54 12.83%
pet - imp
energy_regen Energy 360.02 3550.34 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 402.52 406.10 28830.2 48931.5 46669.0 50000.0
Soul Shard 4.0 0.31 0.32 3.1 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
Necrolord_Marileth
cataclysm Mana 9.7 4826.8 500.0 500.5 47.9
channel_demonfire Mana 12.1 9053.8 750.0 750.4 33.6
chaos_bolt Soul Shard 22.5 44.9 2.0 2.0 12081.1
conflagrate Mana 36.8 18418.1 500.0 499.8 13.3
decimating_bolt Mana 5.0 10087.4 2000.0 2001.5 3.0
havoc Mana 9.6 9564.7 1000.0 999.8 0.0
immolate Mana 27.0 20264.0 750.0 749.9 23.7
incinerate Mana 40.7 40708.3 1000.0 1000.3 6.0
rain_of_fire Soul Shard 16.5 49.5 3.0 3.0 5217.9
soul_fire Mana 6.5 6547.6 1000.0 1182.4 23.2
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.1
pet - imp
firebolt Energy 93.0 3720.9 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
Necrolord_Marileth Fight Length
Count 625
Mean 299.05
Minimum 240.24
Maximum 359.94
Spread ( max - min ) 119.70
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Necrolord_Marileth Damage Per Second
Count 625
Mean 9696.52
Minimum 9186.16
Maximum 10350.37
Spread ( max - min ) 1164.21
Range [ ( max - min ) / 2 * 100% ] 6.00%
Standard Deviation 225.3516
5th Percentile 9382.03
95th Percentile 10097.16
( 95th Percentile - 5th Percentile ) 715.13
Mean Distribution
Standard Deviation 9.0141
95.00% Confidence Interval ( 9678.86 - 9714.19 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2075
0.1 Scale Factor Error with Delta=300 434
0.05 Scale Factor Error with Delta=300 1735
0.01 Scale Factor Error with Delta=300 43352
Priority Target DPS
Necrolord_Marileth Priority Target Damage Per Second
Count 625
Mean 5397.96
Minimum 5034.72
Maximum 5800.64
Spread ( max - min ) 765.91
Range [ ( max - min ) / 2 * 100% ] 7.09%
Standard Deviation 138.2432
5th Percentile 5180.77
95th Percentile 5640.07
( 95th Percentile - 5th Percentile ) 459.31
Mean Distribution
Standard Deviation 5.5297
95.00% Confidence Interval ( 5387.12 - 5408.80 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2520
0.1 Scale Factor Error with Delta=300 164
0.05 Scale Factor Error with Delta=300 653
0.01 Scale Factor Error with Delta=300 16315
DPS(e)
Necrolord_Marileth Damage Per Second (Effective)
Count 625
Mean 9696.52
Minimum 9186.16
Maximum 10350.37
Spread ( max - min ) 1164.21
Range [ ( max - min ) / 2 * 100% ] 6.00%
Damage
Necrolord_Marileth Damage
Count 625
Mean 2510063.36
Minimum 2015994.10
Maximum 3037132.78
Spread ( max - min ) 1021138.68
Range [ ( max - min ) / 2 * 100% ] 20.34%
DTPS
Necrolord_Marileth Damage Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necrolord_Marileth Healing Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necrolord_Marileth Healing Per Second (Effective)
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necrolord_Marileth Heal
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necrolord_Marileth Healing Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necrolord_Marileth Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Necrolord_MarilethTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necrolord_Marileth Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.68 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.70 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.05 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.07 channel_demonfire,if=dot.immolate.remains>cast_time
F 18.34 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.56 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.44 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
J 5.08 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 16.90 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 31.09 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.93 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 0.95 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.80 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.60 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 9.83 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHQNQNPQNQNDEFFFDJKLKDLLALEHNQQNPOILKFIELKLLAILHRNQRNPREIFJKLLL9AHQNQNQPNEILLFFFKLLIKAHRQRRNP9EIFJKLIKLLAHNQRQRNPEFIFMKLLDK9AHQNQQNPDEJLFIKLLFFKAHQNQRRPN9EFIKLILLKAHQRRNQPEJKLFIFLKFLL9AEHQNQNPQNILLFLEFF

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.741 aoe E channel_demonfire Fluffy_Pillow 49370.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.956 cds M summon_infernal Fluffy_Pillow 49728.0/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust
0:04.962 aoe H havoc enemy2 49231.0/50000: 98% mana
4.6/5: 92% soul_shard
bloodlust
0:05.970 havoc Q chaos_bolt Fluffy_Pillow 48735.0/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:07.978 havoc N conflagrate Fluffy_Pillow 49739.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust
0:08.985 havoc Q chaos_bolt Fluffy_Pillow 49742.5/50000: 99% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:10.391 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:11.397 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.9/5: 78% soul_shard
bloodlust, backdraft
0:12.401 havoc Q chaos_bolt Fluffy_Pillow 49251.0/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:13.807 havoc N conflagrate Fluffy_Pillow 49954.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust
0:14.812 havoc Q chaos_bolt Fluffy_Pillow 49956.5/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:16.218 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:17.225 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.0/5: 80% soul_shard
bloodlust, backdraft
0:18.230 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
bloodlust, backdraft
0:20.602 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
bloodlust, backdraft
0:21.608 aoe F immolate enemy2 49252.0/50000: 99% mana
2.6/5: 52% soul_shard
bloodlust, backdraft
0:22.615 aoe F immolate enemy3 49005.5/50000: 98% mana
2.9/5: 58% soul_shard
bloodlust, backdraft
0:23.621 aoe D rain_of_fire Fluffy_Pillow 48758.5/50000: 98% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:24.626 aoe J decimating_bolt Fluffy_Pillow 49261.0/50000: 99% mana
0.5/5: 10% soul_shard
bloodlust, backdraft
0:26.300 aoe K conflagrate Fluffy_Pillow 48002.0/50000: 96% mana
1.0/5: 20% soul_shard
bloodlust
0:27.306 aoe L incinerate Fluffy_Pillow 48005.0/50000: 96% mana
1.8/5: 36% soul_shard
bloodlust, backdraft
0:28.247 aoe K conflagrate Fluffy_Pillow 47475.5/50000: 95% mana
2.4/5: 48% soul_shard
bloodlust, decimating_bolt(2)
0:29.253 aoe D rain_of_fire Fluffy_Pillow 47478.5/50000: 95% mana
3.2/5: 64% soul_shard
bloodlust, backdraft, decimating_bolt(2)
0:30.259 aoe L incinerate Fluffy_Pillow 47981.5/50000: 96% mana
0.7/5: 14% soul_shard
bloodlust, backdraft, decimating_bolt(2)
0:31.198 aoe L incinerate Fluffy_Pillow 47451.0/50000: 95% mana
1.3/5: 26% soul_shard
bloodlust, decimating_bolt
0:32.539 default A cataclysm Fluffy_Pillow 47121.5/50000: 94% mana
2.0/5: 40% soul_shard
bloodlust
0:33.876 aoe L incinerate Fluffy_Pillow 47290.0/50000: 95% mana
2.5/5: 50% soul_shard
bloodlust
0:35.218 aoe E channel_demonfire Fluffy_Pillow 46961.0/50000: 94% mana
2.9/5: 58% soul_shard
bloodlust
0:37.390 aoe H havoc enemy2 47297.0/50000: 95% mana
3.2/5: 64% soul_shard
bloodlust
0:38.394 havoc N conflagrate Fluffy_Pillow 46799.0/50000: 94% mana
3.4/5: 68% soul_shard
bloodlust
0:39.400 havoc Q chaos_bolt Fluffy_Pillow 46802.0/50000: 94% mana
4.6/5: 92% soul_shard
bloodlust, backdraft
0:40.807 havoc Q chaos_bolt Fluffy_Pillow 47505.5/50000: 95% mana
2.9/5: 58% soul_shard
bloodlust
0:42.816 havoc N conflagrate Fluffy_Pillow 48510.0/50000: 97% mana
1.3/5: 26% soul_shard
0:44.123 havoc P immolate Fluffy_Pillow 48663.5/50000: 97% mana
2.3/5: 46% soul_shard
backdraft
0:45.429 havoc O soul_fire Fluffy_Pillow 48566.5/50000: 97% mana
2.7/5: 54% soul_shard
backdraft
0:48.909 aoe I rain_of_fire Fluffy_Pillow 49003.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:50.214 aoe L incinerate Fluffy_Pillow 49656.0/50000: 99% mana
2.3/5: 46% soul_shard
backdraft
0:51.433 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.6/5: 52% soul_shard
0:52.741 aoe F immolate enemy3 49156.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
0:54.047 aoe I rain_of_fire Fluffy_Pillow 49059.0/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
0:55.355 aoe E channel_demonfire Fluffy_Pillow 49713.0/50000: 99% mana
0.7/5: 14% soul_shard
backdraft
0:58.304 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
backdraft
0:59.524 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
1:00.829 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
1:02.047 aoe L incinerate Fluffy_Pillow 48764.0/50000: 98% mana
2.4/5: 48% soul_shard
1:03.787 default A cataclysm Fluffy_Pillow 48634.0/50000: 97% mana
2.9/5: 58% soul_shard
1:05.615 aoe I rain_of_fire Fluffy_Pillow 49048.0/50000: 98% mana
3.3/5: 66% soul_shard
1:06.921 aoe L incinerate Fluffy_Pillow 49701.0/50000: 99% mana
0.5/5: 10% soul_shard
1:08.661 aoe H havoc enemy2 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
1:09.967 havoc R incinerate Fluffy_Pillow 48655.0/50000: 97% mana
1.0/5: 20% soul_shard
1:11.707 havoc N conflagrate Fluffy_Pillow 48525.0/50000: 97% mana
1.7/5: 34% soul_shard
1:13.013 havoc Q chaos_bolt Fluffy_Pillow 48678.0/50000: 97% mana
2.9/5: 58% soul_shard
backdraft
1:14.842 havoc R incinerate Fluffy_Pillow 49592.5/50000: 99% mana
1.0/5: 20% soul_shard
1:16.582 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.7/5: 34% soul_shard
1:17.889 havoc P immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
1:19.194 havoc R incinerate Fluffy_Pillow 49058.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
1:20.412 aoe E channel_demonfire Fluffy_Pillow 48667.0/50000: 97% mana
3.4/5: 68% soul_shard
1:23.288 aoe I rain_of_fire Fluffy_Pillow 49355.0/50000: 99% mana
3.7/5: 74% soul_shard
1:24.594 aoe F immolate enemy3 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
1:25.900 aoe J decimating_bolt Fluffy_Pillow 49252.0/50000: 99% mana
1.0/5: 20% soul_shard
1:28.075 aoe K conflagrate Fluffy_Pillow 48002.0/50000: 96% mana
1.3/5: 26% soul_shard
1:29.382 aoe L incinerate Fluffy_Pillow 48155.5/50000: 96% mana
2.0/5: 40% soul_shard
backdraft
1:30.601 aoe L incinerate Fluffy_Pillow 47765.0/50000: 96% mana
2.3/5: 46% soul_shard
decimating_bolt(2)
1:32.340 aoe L incinerate Fluffy_Pillow 47634.5/50000: 95% mana
2.8/5: 56% soul_shard
decimating_bolt
1:34.080 default 9 soul_fire Fluffy_Pillow 47504.5/50000: 95% mana
3.2/5: 64% soul_shard
1:37.557 default A cataclysm Fluffy_Pillow 48243.0/50000: 96% mana
4.6/5: 92% soul_shard
1:39.297 aoe H havoc enemy2 48613.0/50000: 97% mana
4.8/5: 96% soul_shard
1:40.603 havoc Q chaos_bolt Fluffy_Pillow 48266.0/50000: 97% mana
5.0/5: 100% soul_shard
1:43.215 havoc N conflagrate Fluffy_Pillow 49572.0/50000: 99% mana
3.0/5: 60% soul_shard
1:44.521 havoc Q chaos_bolt Fluffy_Pillow 49725.0/50000: 99% mana
4.2/5: 84% soul_shard
backdraft
1:46.348 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
1:47.654 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.5/5: 70% soul_shard
backdraft
1:49.482 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
1:50.788 havoc N conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
1.9/5: 38% soul_shard
1:52.093 aoe E channel_demonfire Fluffy_Pillow 49404.5/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
1:55.015 aoe I rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.5/5: 70% soul_shard
backdraft
1:56.322 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
1:57.540 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
1.0/5: 20% soul_shard
1:59.280 aoe F immolate enemy3 48871.5/50000: 98% mana
1.3/5: 26% soul_shard
2:00.586 aoe F immolate enemy2 48774.5/50000: 98% mana
1.5/5: 30% soul_shard
2:01.894 aoe F immolate Fluffy_Pillow 48678.5/50000: 97% mana
1.6/5: 32% soul_shard
2:03.201 aoe K conflagrate Fluffy_Pillow 48582.0/50000: 97% mana
1.8/5: 36% soul_shard
2:04.507 aoe L incinerate Fluffy_Pillow 48735.0/50000: 97% mana
2.4/5: 48% soul_shard
backdraft
2:05.724 aoe L incinerate Fluffy_Pillow 48343.5/50000: 97% mana
2.8/5: 56% soul_shard
2:07.464 aoe I rain_of_fire Fluffy_Pillow 48213.5/50000: 96% mana
3.1/5: 62% soul_shard
2:08.772 aoe K conflagrate Fluffy_Pillow 48867.5/50000: 98% mana
0.3/5: 6% soul_shard
2:10.078 default A cataclysm Fluffy_Pillow 49020.5/50000: 98% mana
1.0/5: 20% soul_shard
backdraft
2:11.819 aoe H havoc enemy2 49391.0/50000: 99% mana
1.3/5: 26% soul_shard
backdraft
2:13.125 havoc R incinerate Fluffy_Pillow 49044.0/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
2:14.346 havoc Q chaos_bolt Fluffy_Pillow 48654.5/50000: 97% mana
2.0/5: 40% soul_shard
2:16.956 havoc R incinerate Fluffy_Pillow 49959.5/50000: 100% mana
0.3/5: 6% soul_shard
2:18.695 havoc R incinerate Fluffy_Pillow 49001.5/50000: 98% mana
0.9/5: 18% soul_shard
2:20.436 havoc N conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
1.4/5: 28% soul_shard
2:21.742 havoc P immolate Fluffy_Pillow 49025.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:23.050 default 9 soul_fire Fluffy_Pillow 48929.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
2:26.527 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
4.3/5: 86% soul_shard
backdraft
2:29.280 aoe I rain_of_fire Fluffy_Pillow 49628.5/50000: 99% mana
4.7/5: 94% soul_shard
backdraft
2:30.587 aoe F immolate enemy3 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
2:31.895 aoe J decimating_bolt Fluffy_Pillow 49253.0/50000: 99% mana
2.0/5: 40% soul_shard
2:34.070 aoe K conflagrate Fluffy_Pillow 48002.0/50000: 96% mana
2.3/5: 46% soul_shard
2:35.377 aoe L incinerate Fluffy_Pillow 48155.5/50000: 96% mana
2.9/5: 58% soul_shard
backdraft
2:36.596 aoe I rain_of_fire Fluffy_Pillow 47765.0/50000: 96% mana
3.4/5: 68% soul_shard
decimating_bolt(2)
2:37.900 aoe K conflagrate Fluffy_Pillow 48417.0/50000: 97% mana
0.5/5: 10% soul_shard
decimating_bolt(2)
2:39.207 aoe L incinerate Fluffy_Pillow 48570.5/50000: 97% mana
1.4/5: 28% soul_shard
backdraft, decimating_bolt(2)
2:40.428 aoe L incinerate Fluffy_Pillow 48181.0/50000: 96% mana
1.7/5: 34% soul_shard
decimating_bolt
2:42.169 default A cataclysm Fluffy_Pillow 48051.5/50000: 96% mana
2.1/5: 42% soul_shard
2:43.909 aoe H havoc enemy2 48421.5/50000: 97% mana
2.2/5: 44% soul_shard
2:45.216 havoc N conflagrate Fluffy_Pillow 48075.0/50000: 96% mana
2.4/5: 48% soul_shard
2:46.522 havoc Q chaos_bolt Fluffy_Pillow 48228.0/50000: 96% mana
3.5/5: 70% soul_shard
backdraft
2:48.352 havoc R incinerate Fluffy_Pillow 49143.0/50000: 98% mana
1.8/5: 36% soul_shard
2:50.093 havoc Q chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
2.4/5: 48% soul_shard
2:52.701 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
2:54.440 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.3/5: 26% soul_shard
2:55.747 havoc P immolate Fluffy_Pillow 49155.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
2:57.053 aoe E channel_demonfire Fluffy_Pillow 49058.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
2:59.877 aoe F immolate enemy2 49720.0/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
3:01.184 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
3:02.490 aoe F immolate enemy3 49905.5/50000: 100% mana
0.3/5: 6% soul_shard
backdraft
3:03.798 cds M summon_infernal Fluffy_Pillow 49253.0/50000: 99% mana
0.4/5: 8% soul_shard
backdraft
3:05.262 aoe K conflagrate Fluffy_Pillow 48985.0/50000: 98% mana
0.9/5: 18% soul_shard
3:06.569 aoe L incinerate Fluffy_Pillow 49138.5/50000: 98% mana
1.8/5: 36% soul_shard
backdraft
3:07.790 aoe L incinerate Fluffy_Pillow 48749.0/50000: 97% mana
2.4/5: 48% soul_shard
3:09.530 aoe D rain_of_fire Fluffy_Pillow 48619.0/50000: 97% mana
3.1/5: 62% soul_shard
3:10.836 aoe K conflagrate Fluffy_Pillow 49272.0/50000: 99% mana
0.5/5: 10% soul_shard
3:12.141 default 9 soul_fire Fluffy_Pillow 49424.5/50000: 99% mana
1.4/5: 28% soul_shard
backdraft
3:15.621 default A cataclysm Fluffy_Pillow 49003.5/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
3:17.361 aoe H havoc enemy2 49373.5/50000: 99% mana
4.0/5: 80% soul_shard
backdraft
3:18.667 havoc Q chaos_bolt Fluffy_Pillow 49026.5/50000: 98% mana
4.4/5: 88% soul_shard
backdraft
3:20.497 havoc N conflagrate Fluffy_Pillow 49941.5/50000: 100% mana
3.0/5: 60% soul_shard
3:21.804 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft
3:23.630 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:26.240 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
3:27.546 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.3/5: 66% soul_shard
backdraft
3:28.853 aoe D rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.8/5: 76% soul_shard
backdraft
3:30.159 aoe E channel_demonfire Fluffy_Pillow 49905.5/50000: 100% mana
1.1/5: 22% soul_shard
backdraft
3:33.048 aoe J decimating_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.0/5: 40% soul_shard
backdraft
3:35.224 aoe L incinerate Fluffy_Pillow 48002.5/50000: 96% mana
2.6/5: 52% soul_shard
backdraft
3:36.443 aoe F immolate enemy3 47612.0/50000: 95% mana
2.9/5: 58% soul_shard
3:37.750 aoe I rain_of_fire Fluffy_Pillow 47515.5/50000: 95% mana
3.2/5: 64% soul_shard
decimating_bolt(3)
3:39.057 aoe K conflagrate Fluffy_Pillow 48169.0/50000: 96% mana
0.4/5: 8% soul_shard
decimating_bolt(3)
3:40.362 aoe L incinerate Fluffy_Pillow 48321.5/50000: 97% mana
1.1/5: 22% soul_shard
backdraft, decimating_bolt(3)
3:41.584 aoe L incinerate Fluffy_Pillow 47932.5/50000: 96% mana
1.4/5: 28% soul_shard
decimating_bolt(2)
3:43.323 aoe F immolate Fluffy_Pillow 47802.0/50000: 96% mana
1.8/5: 36% soul_shard
decimating_bolt
3:44.631 aoe F immolate enemy2 47706.0/50000: 95% mana
2.1/5: 42% soul_shard
decimating_bolt
3:45.937 aoe K conflagrate Fluffy_Pillow 47609.0/50000: 95% mana
2.2/5: 44% soul_shard
decimating_bolt
3:47.243 default A cataclysm Fluffy_Pillow 47762.0/50000: 96% mana
3.0/5: 60% soul_shard
backdraft, decimating_bolt
3:49.096 aoe H havoc enemy2 48188.5/50000: 96% mana
3.0/5: 60% soul_shard
backdraft, decimating_bolt
3:50.404 havoc Q chaos_bolt Fluffy_Pillow 47842.5/50000: 96% mana
3.4/5: 68% soul_shard
backdraft, decimating_bolt
3:52.230 havoc N conflagrate Fluffy_Pillow 48755.5/50000: 98% mana
1.6/5: 32% soul_shard
decimating_bolt
3:53.537 havoc Q chaos_bolt Fluffy_Pillow 48909.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft, decimating_bolt
3:55.365 havoc R incinerate Fluffy_Pillow 49823.0/50000: 100% mana
1.3/5: 26% soul_shard
decimating_bolt
3:57.104 havoc R incinerate Fluffy_Pillow 49001.5/50000: 98% mana
1.8/5: 36% soul_shard
3:58.844 havoc P immolate Fluffy_Pillow 48871.5/50000: 98% mana
2.5/5: 50% soul_shard
4:00.151 havoc N conflagrate Fluffy_Pillow 48775.0/50000: 98% mana
2.8/5: 56% soul_shard
4:01.548 default 9 soul_fire Fluffy_Pillow 48973.5/50000: 98% mana
3.8/5: 76% soul_shard
backdraft
4:05.026 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
4:07.818 aoe F immolate enemy3 49648.5/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
4:09.126 aoe I rain_of_fire Fluffy_Pillow 49253.0/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
4:10.431 aoe K conflagrate Fluffy_Pillow 49905.5/50000: 100% mana
2.1/5: 42% soul_shard
4:11.736 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
4:12.957 aoe I rain_of_fire Fluffy_Pillow 49003.0/50000: 98% mana
3.1/5: 62% soul_shard
4:14.264 aoe L incinerate Fluffy_Pillow 49656.5/50000: 99% mana
0.3/5: 6% soul_shard
4:16.005 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
0.8/5: 16% soul_shard
4:17.746 aoe K conflagrate Fluffy_Pillow 48873.0/50000: 98% mana
1.0/5: 20% soul_shard
4:19.052 default A cataclysm Fluffy_Pillow 49026.0/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
4:20.835 aoe H havoc enemy2 49417.5/50000: 99% mana
2.3/5: 46% soul_shard
backdraft
4:22.142 havoc Q chaos_bolt Fluffy_Pillow 49071.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
4:23.968 havoc R incinerate Fluffy_Pillow 49984.0/50000: 100% mana
0.7/5: 14% soul_shard
4:25.708 havoc R incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
4:27.448 havoc N conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
1.8/5: 36% soul_shard
4:28.754 havoc Q chaos_bolt Fluffy_Pillow 49025.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
4:30.581 havoc P immolate Fluffy_Pillow 49938.5/50000: 100% mana
1.1/5: 22% soul_shard
4:31.888 aoe E channel_demonfire Fluffy_Pillow 49252.5/50000: 99% mana
1.4/5: 28% soul_shard
4:34.596 aoe J decimating_bolt Fluffy_Pillow 49856.5/50000: 100% mana
1.7/5: 34% soul_shard
4:36.771 aoe K conflagrate Fluffy_Pillow 48002.0/50000: 96% mana
2.0/5: 40% soul_shard
4:38.075 aoe L incinerate Fluffy_Pillow 48154.0/50000: 96% mana
2.5/5: 50% soul_shard
backdraft
4:39.293 aoe F immolate enemy3 47763.0/50000: 96% mana
3.0/5: 60% soul_shard
decimating_bolt(2)
4:40.600 aoe I rain_of_fire Fluffy_Pillow 47666.5/50000: 95% mana
3.0/5: 60% soul_shard
decimating_bolt(2)
4:41.906 aoe F immolate enemy2 48319.5/50000: 97% mana
0.4/5: 8% soul_shard
decimating_bolt(2)
4:43.212 aoe L incinerate Fluffy_Pillow 48222.5/50000: 96% mana
0.4/5: 8% soul_shard
decimating_bolt(2)
4:44.953 aoe K conflagrate Fluffy_Pillow 48093.0/50000: 96% mana
0.9/5: 18% soul_shard
decimating_bolt
4:46.259 aoe F immolate Fluffy_Pillow 48246.0/50000: 96% mana
1.4/5: 28% soul_shard
backdraft, decimating_bolt
4:47.565 aoe L incinerate Fluffy_Pillow 48149.0/50000: 96% mana
1.7/5: 34% soul_shard
backdraft, decimating_bolt
4:48.785 aoe L incinerate Fluffy_Pillow 47759.0/50000: 96% mana
1.9/5: 38% soul_shard
4:50.525 default 9 soul_fire Fluffy_Pillow 47629.0/50000: 95% mana
2.5/5: 50% soul_shard
4:54.002 default A cataclysm Fluffy_Pillow 48367.5/50000: 97% mana
3.8/5: 76% soul_shard
4:55.742 aoe E channel_demonfire Fluffy_Pillow 48737.5/50000: 97% mana
4.1/5: 82% soul_shard
4:58.530 aoe H havoc enemy2 49381.5/50000: 99% mana
4.5/5: 90% soul_shard
4:59.839 havoc Q chaos_bolt Fluffy_Pillow 49036.0/50000: 98% mana
4.6/5: 92% soul_shard
5:02.447 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
5:03.753 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
backdraft
5:05.581 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
5:06.886 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.5/5: 70% soul_shard
backdraft
5:08.193 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
3.8/5: 76% soul_shard
backdraft
5:10.023 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
5:11.328 aoe I rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.1/5: 62% soul_shard
backdraft
5:12.634 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft
5:13.852 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
0.6/5: 12% soul_shard
5:15.592 aoe F immolate enemy3 48871.5/50000: 98% mana
1.1/5: 22% soul_shard
5:16.898 aoe L incinerate Fluffy_Pillow 48774.5/50000: 98% mana
1.3/5: 26% soul_shard
5:18.638 aoe E channel_demonfire Fluffy_Pillow 48644.5/50000: 97% mana
1.8/5: 36% soul_shard
5:21.500 aoe F immolate Fluffy_Pillow 49325.5/50000: 99% mana
2.1/5: 42% soul_shard
5:22.805 aoe F immolate enemy2 49228.0/50000: 98% mana
2.3/5: 46% soul_shard

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Necrolord_Marileth"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=necrolord
soulbind=infernal_brand:6/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

NightFae_Dream : 9713 dps, 5242 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9712.7 9712.7 17.3 / 0.179% 823.8 / 8.5% 21.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
388.7 386.1 Mana 0.00% 38.5 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Dream 9713
Cataclysm 777 8.0% 9.7 32.34sec 24016 14135 Direct 29.0 6700 13406 8008 19.5%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.67 29.02 0.00 0.00 1.6992 0.0000 232325.83 232325.83 0.00% 14135.18 14135.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.53% 23.37 12 33 6699.97 6142 7260 6699.09 6416 6899 156580 156580 0.00%
crit 19.47% 5.65 0 13 13406.05 12283 14521 13361.52 0 14500 75746 75746 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.73
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1025) 0.0% (10.6%) 12.0 25.53sec 25463 9458

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.02 0.00 179.45 0.00 2.6921 0.1634 0.00 0.00 0.00% 9458.47 9458.47

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [F]:12.02
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1025 10.6% 0.0 0.00sec 0 0 Direct 538.4 476 953 568 19.4%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 538.36 0.00 0.00 0.0000 0.0000 306000.44 306000.44 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 434.18 311 562 476.08 263 976 476.38 449 504 206703 206703 0.00%
crit 19.35% 104.18 60 152 952.74 525 1952 953.73 819 1095 99297 99297 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1303 (1751) 13.4% (18.0%) 21.6 13.61sec 24150 12326 Direct 43.0 (85.7) 0 9035 9035 100.0% (59.8%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.63 43.02 0.00 0.00 1.9593 0.0000 388699.61 388699.61 0.00% 12326.05 12326.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 43.02 32 58 9035.10 5862 12241 9035.57 8832 9231 388700 388700 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:21.71
  • if_expr:cast_time<havoc_remains
    Internal Combustion 448 4.6% 42.7 13.64sec 3130 0 Direct 42.7 2624 5245 3130 19.3%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.69 42.68 0.00 0.00 0.0000 0.0000 133628.90 133628.90 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 34.44 22 51 2624.13 1 3715 2626.64 2408 2907 90407 90407 0.00%
crit 19.30% 8.24 1 19 5245.43 94 7430 5238.16 3341 6645 43222 43222 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 809 8.3% 36.8 7.96sec 6563 5247 Direct 56.5 3583 7171 4274 19.3%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.82 56.53 0.00 0.00 1.2507 0.0000 241658.07 241658.07 0.00% 5247.16 5247.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 45.64 30 59 3583.19 2047 5042 3583.25 3374 3829 163520 163520 0.00%
crit 19.26% 10.89 2 22 7171.41 4095 10083 7179.65 5369 9463 78138 78138 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:17.14
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.68
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1607 16.6% 26.5 11.05sec 18110 14359 Direct 33.7 1527 3063 1815 18.8%
Periodic 346.2 1014 2028 1210 19.4% 95.8%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.52 33.73 346.20 346.20 1.2613 2.4828 480345.97 480345.97 0.00% 537.91 14359.26
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.23% 27.40 16 38 1527.26 819 2017 1528.24 1427 1668 41848 41848 0.00%
crit 18.77% 6.33 1 15 3063.36 1639 4034 3057.97 2039 3888 19382 19382 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.62% 279.12 213 352 1014.23 1 1261 1014.37 995 1034 283109 283109 0.00%
crit 19.38% 67.08 36 97 2027.52 1 2521 2027.60 1911 2139 136008 136008 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [G]:17.85
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.79
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 614 6.3% 44.6 6.08sec 4117 2811 Direct 55.2 (55.2) 2792 5600 3329 19.1% (19.1%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.63 55.20 0.00 0.00 1.4650 0.0000 183762.57 183762.57 0.00% 2810.56 2810.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.88% 44.64 27 66 2792.32 1314 3426 2795.47 2585 3005 124676 124676 0.00%
crit 19.12% 10.56 1 21 5599.89 2783 6852 5604.83 4357 6644 59086 59086 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:33.87
    havoc
    [R]:11.01
  • if_expr:cast_time<havoc_remains
Rain of Fire 912 9.4% 17.4 16.18sec 15642 12550 Periodic 413.2 553 1106 659 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.42 0.00 0.00 413.23 1.2464 0.0000 272498.16 272498.16 0.00% 12550.00 12550.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.73% 333.60 226 458 552.95 507 599 552.91 546 560 184460 184460 0.00%
crit 19.27% 79.62 44 125 1105.67 1013 1198 1105.75 1084 1130 88038 88038 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.30
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [J]:12.12
Soul Fire 508 5.2% 5.5 49.40sec 27463 7898 Direct 7.8 16451 32535 19380 18.3%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.52 7.82 0.00 0.00 3.4775 0.0000 151685.52 151685.52 0.00% 7897.82 7897.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.73% 6.39 3 11 16450.67 8602 21177 16526.03 13569 20220 105194 105194 0.00%
crit 18.27% 1.43 0 5 32534.68 17237 42290 25618.91 0 42289 46492 46492 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.28
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.36
  • if_expr:cast_time<havoc_remains
Soul Rot 340 3.5% 5.3 62.49sec 19300 15447 Periodic 96.5 882 1770 1053 19.2% 13.9%

Stats Details: Soul Rot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.27 0.00 96.53 96.53 1.2495 1.2895 101654.93 101654.93 0.00% 775.63 15446.73
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.78% 77.98 54 98 882.50 424 1395 882.64 828 926 68813 68813 0.00%
crit 19.22% 18.55 9 36 1769.69 849 2790 1769.60 1340 2252 32841 32841 0.00%

Action Details: Soul Rot

  • id:325640
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • harmful:true

Resources

  • resource:mana
  • base_cost:250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:325640
  • name:Soul Rot
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.

Action Priority List

    aoe
    [E]:5.30
Summon Infernal 81 0.8% 2.0 180.75sec 11952 10334 Direct 6.0 3348 6696 3980 19.0%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23903.01 23903.01 0.00% 10334.20 10334.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.01% 4.86 1 6 3348.13 3348 3348 3348.13 3348 3348 16275 16275 0.00%
crit 18.99% 1.14 0 5 6696.27 6696 6696 4757.03 0 6696 7628 7628 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3821 / 777
Immolation 3555 7.4% 39.0 5.50sec 5470 0 Direct 117.0 1529 3057 1823 19.2%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 213326.69 213326.69 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 94.49 79 107 1529.31 1395 2023 1529.28 1500 1559 144505 144505 0.00%
crit 19.24% 22.51 10 38 3057.45 2790 4046 3058.45 2790 3336 68821 68821 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.5% 41.0 5.26sec 388 270 Direct 41.0 326 651 388 19.3%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15926.53 22749.46 29.99% 270.38 270.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 33.08 23 41 325.55 326 326 325.55 326 326 10769 15382 29.99%
crit 19.32% 7.92 0 18 651.10 651 651 649.02 0 651 5158 7367 29.90%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 512 / 512
Firebolt 512 5.3% 93.0 3.22sec 1646 1131 Direct 92.3 1395 2790 1659 18.9%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.02 92.30 0.00 0.00 1.4558 0.0000 153148.16 153148.16 0.00% 1130.90 1130.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.06% 74.82 55 93 1395.06 1395 1395 1395.06 1395 1395 104381 104381 0.00%
crit 18.94% 17.48 8 35 2790.11 2790 2790 2790.11 2790 2790 48767 48767 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.47
Simple Action Stats Execute Interval
NightFae_Dream
Havoc 9.6 32.06sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.62 0.00 0.00 0.00 1.2441 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [I]:9.63
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.8 0.0 8.0sec 8.0sec 4.1sec 50.65% 0.00% 0.0 (0.0) 1.6

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 24.5s
  • trigger_min/max:2.1s / 24.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:50.65%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.56% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.56%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Soul Rot 5.3 0.0 62.4sec 62.4sec 7.9sec 13.91% 0.00% 0.0 (0.0) 5.1

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_soul_rot
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:61.3s / 68.4s
  • trigger_min/max:61.3s / 68.4s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 8.0s

Stack Uptimes

  • soul_rot_1:13.91%

Spelldata

  • id:325640
  • name:Soul Rot
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 184.9s
  • trigger_min/max:180.0s / 184.9s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 184.9s
  • trigger_min/max:180.0s / 184.9s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.19% 11.12% 18.01% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Dream
soul_fire Soul Shard 6.53 7.16 7.56% 1.10 0.71 9.00%
immolate Soul Shard 346.22 33.46 35.30% 0.10 1.16 3.35%
incinerate Soul Shard 44.65 11.11 11.72% 0.25 0.01 0.05%
conflagrate Soul Shard 36.82 28.25 29.80% 0.77 0.00 0.00%
mana_regen Mana 657.55 115503.73 100.00% 175.66 33738.44 22.61%
immolate_crits Soul Shard 33.47 3.23 3.41% 0.10 0.12 3.54%
incinerate_crits Soul Shard 10.56 1.06 1.11% 0.10 0.00 0.04%
infernal Soul Shard 120.00 10.52 11.10% 0.09 1.48 12.32%
pet - imp
energy_regen Energy 360.02 3550.34 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 386.13 388.71 33756.1 49226.1 48038.0 50000.0
Soul Shard 4.0 0.32 0.32 3.5 2.3 0.0 5.0
Usage Type Count Total Avg RPE APR
NightFae_Dream
cataclysm Mana 9.7 4840.9 500.0 500.4 48.0
channel_demonfire Mana 12.0 9015.2 750.0 750.2 33.9
chaos_bolt Soul Shard 21.6 43.2 2.0 2.0 12084.5
conflagrate Mana 36.8 18408.0 500.0 499.9 13.1
havoc Mana 9.6 9625.6 1000.0 1000.5 0.0
immolate Mana 26.5 19889.6 750.0 749.9 24.2
incinerate Mana 44.7 44650.5 1000.0 1000.5 4.1
rain_of_fire Soul Shard 17.4 52.3 3.0 3.0 5214.4
soul_fire Mana 6.5 6532.0 1000.0 1182.6 23.2
soul_rot Mana 5.3 1315.1 250.0 249.7 77.3
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 93.0 3720.9 40.0 40.0 41.2

Statistics & Data Analysis

Fight Length
NightFae_Dream Fight Length
Count 625
Mean 299.05
Minimum 240.24
Maximum 359.94
Spread ( max - min ) 119.70
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
NightFae_Dream Damage Per Second
Count 625
Mean 9712.70
Minimum 9250.39
Maximum 10364.33
Spread ( max - min ) 1113.94
Range [ ( max - min ) / 2 * 100% ] 5.73%
Standard Deviation 221.2377
5th Percentile 9386.05
95th Percentile 10098.52
( 95th Percentile - 5th Percentile ) 712.47
Mean Distribution
Standard Deviation 8.8495
95.00% Confidence Interval ( 9695.35 - 9730.04 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1994
0.1 Scale Factor Error with Delta=300 418
0.05 Scale Factor Error with Delta=300 1672
0.01 Scale Factor Error with Delta=300 41784
Priority Target DPS
NightFae_Dream Priority Target Damage Per Second
Count 625
Mean 5242.48
Minimum 4944.59
Maximum 5672.27
Spread ( max - min ) 727.69
Range [ ( max - min ) / 2 * 100% ] 6.94%
Standard Deviation 128.4035
5th Percentile 5048.17
95th Percentile 5467.38
( 95th Percentile - 5th Percentile ) 419.21
Mean Distribution
Standard Deviation 5.1361
95.00% Confidence Interval ( 5232.41 - 5252.55 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2305
0.1 Scale Factor Error with Delta=300 141
0.05 Scale Factor Error with Delta=300 563
0.01 Scale Factor Error with Delta=300 14075
DPS(e)
NightFae_Dream Damage Per Second (Effective)
Count 625
Mean 9712.70
Minimum 9250.39
Maximum 10364.33
Spread ( max - min ) 1113.94
Range [ ( max - min ) / 2 * 100% ] 5.73%
Damage
NightFae_Dream Damage
Count 625
Mean 2516163.00
Minimum 2013358.21
Maximum 3034916.57
Spread ( max - min ) 1021558.36
Range [ ( max - min ) / 2 * 100% ] 20.30%
DTPS
NightFae_Dream Damage Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Dream Healing Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Dream Healing Per Second (Effective)
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Dream Heal
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Dream Healing Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Dream Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_DreamTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Dream Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.28 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.73 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.30 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
E 5.30 soul_rot
F 12.02 channel_demonfire,if=dot.immolate.remains>cast_time
G 17.85 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
H 0.00 call_action_list,name=cds
I 9.63 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
J 12.12 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 17.14 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 33.87 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.68 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.36 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.79 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 21.71 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 11.01 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEFMIQNQNPQNQNDFGGGDLKLLDKALLJFINQRRNOPGJLKFJLKAELLINQQPRNFGJLKLLLLA9IQNQNQPNFGJLLKLLJAEINQRRNPRFJ9GKJLKLLAIQNQRRPNFJLGKLLMDGKEAIOQNQRDFGGDGKLKLJLLAINQRNQPFLKL9GJKGELJAIRNQRRNPFGJLGKLLJLKLAIRNOQRNFJLLGJKEGGLKAI

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.740 aoe E soul_rot Fluffy_Pillow 49370.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:02.747 aoe F channel_demonfire Fluffy_Pillow 49623.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, soul_rot
0:04.957 cds M summon_infernal Fluffy_Pillow 49978.5/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, soul_rot
0:05.963 aoe I havoc enemy2 49481.5/50000: 99% mana
4.8/5: 96% soul_shard
bloodlust, soul_rot
0:06.969 havoc Q chaos_bolt Fluffy_Pillow 48984.5/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust, soul_rot
0:08.978 havoc N conflagrate Fluffy_Pillow 49989.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, soul_rot
0:09.985 havoc Q chaos_bolt Fluffy_Pillow 49992.5/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, soul_rot
0:11.392 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:12.398 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:13.407 havoc Q chaos_bolt Fluffy_Pillow 49253.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:14.814 havoc N conflagrate Fluffy_Pillow 49957.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:15.821 havoc Q chaos_bolt Fluffy_Pillow 49960.5/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:17.227 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:18.232 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:19.238 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
bloodlust, backdraft
0:21.662 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
bloodlust, backdraft
0:22.669 aoe G immolate enemy2 49252.5/50000: 99% mana
2.8/5: 56% soul_shard
bloodlust, backdraft
0:23.675 aoe G immolate enemy3 49005.5/50000: 98% mana
3.0/5: 60% soul_shard
bloodlust, backdraft
0:24.680 aoe D rain_of_fire Fluffy_Pillow 48758.0/50000: 98% mana
3.3/5: 66% soul_shard
bloodlust, backdraft
0:25.687 aoe L incinerate Fluffy_Pillow 49261.5/50000: 99% mana
0.6/5: 12% soul_shard
bloodlust, backdraft
0:26.626 aoe K conflagrate Fluffy_Pillow 48731.0/50000: 97% mana
1.1/5: 22% soul_shard
bloodlust
0:27.632 aoe L incinerate Fluffy_Pillow 48734.0/50000: 97% mana
1.9/5: 38% soul_shard
bloodlust, backdraft
0:28.571 aoe L incinerate Fluffy_Pillow 48203.5/50000: 96% mana
2.5/5: 50% soul_shard
bloodlust
0:29.910 aoe D rain_of_fire Fluffy_Pillow 47873.0/50000: 96% mana
3.3/5: 66% soul_shard
bloodlust
0:30.917 aoe K conflagrate Fluffy_Pillow 48376.5/50000: 97% mana
0.6/5: 12% soul_shard
bloodlust
0:31.924 default A cataclysm Fluffy_Pillow 48380.0/50000: 97% mana
1.6/5: 32% soul_shard
bloodlust, backdraft
0:33.263 aoe L incinerate Fluffy_Pillow 48549.5/50000: 97% mana
2.0/5: 40% soul_shard
bloodlust, backdraft
0:34.202 aoe L incinerate Fluffy_Pillow 48019.0/50000: 96% mana
2.6/5: 52% soul_shard
bloodlust
0:35.541 aoe J rain_of_fire Fluffy_Pillow 47688.5/50000: 95% mana
3.1/5: 62% soul_shard
bloodlust
0:36.547 aoe F channel_demonfire Fluffy_Pillow 48191.5/50000: 96% mana
0.4/5: 8% soul_shard
bloodlust
0:38.831 aoe I havoc enemy2 48583.5/50000: 97% mana
0.9/5: 18% soul_shard
bloodlust
0:39.839 havoc N conflagrate Fluffy_Pillow 48087.5/50000: 96% mana
1.1/5: 22% soul_shard
bloodlust
0:40.847 havoc Q chaos_bolt Fluffy_Pillow 48091.5/50000: 96% mana
2.2/5: 44% soul_shard
bloodlust, backdraft
0:42.253 havoc R incinerate Fluffy_Pillow 48794.5/50000: 98% mana
0.5/5: 10% soul_shard
0:43.993 havoc R incinerate Fluffy_Pillow 48664.5/50000: 97% mana
1.0/5: 20% soul_shard
0:45.733 havoc N conflagrate Fluffy_Pillow 48534.5/50000: 97% mana
1.8/5: 36% soul_shard
0:47.040 havoc O soul_fire Fluffy_Pillow 48688.0/50000: 97% mana
3.0/5: 60% soul_shard
backdraft
0:50.517 havoc P immolate Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:51.825 aoe G immolate enemy3 48906.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:53.132 aoe J rain_of_fire Fluffy_Pillow 48809.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:54.437 aoe L incinerate Fluffy_Pillow 49462.0/50000: 99% mana
2.2/5: 44% soul_shard
backdraft
0:55.657 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.5/5: 50% soul_shard
0:56.963 aoe F channel_demonfire Fluffy_Pillow 49155.5/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
0:59.834 aoe J rain_of_fire Fluffy_Pillow 49841.0/50000: 100% mana
3.5/5: 70% soul_shard
backdraft
1:01.139 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft
1:02.360 aoe K conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.0/5: 20% soul_shard
1:03.665 default A cataclysm Fluffy_Pillow 49155.5/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
1:05.404 aoe E soul_rot Fluffy_Pillow 49501.5/50000: 99% mana
1.9/5: 38% soul_shard
backdraft
1:06.710 aoe L incinerate Fluffy_Pillow 49752.0/50000: 100% mana
2.0/5: 40% soul_shard
backdraft, soul_rot
1:07.932 aoe L incinerate Fluffy_Pillow 49003.5/50000: 98% mana
2.4/5: 48% soul_shard
soul_rot
1:09.672 aoe I havoc enemy2 48873.5/50000: 98% mana
2.7/5: 54% soul_shard
soul_rot
1:10.977 havoc N conflagrate Fluffy_Pillow 48526.0/50000: 97% mana
2.9/5: 58% soul_shard
soul_rot
1:12.284 havoc Q chaos_bolt Fluffy_Pillow 48679.5/50000: 97% mana
4.0/5: 80% soul_shard
backdraft, soul_rot
1:14.111 havoc Q chaos_bolt Fluffy_Pillow 49593.0/50000: 99% mana
2.3/5: 46% soul_shard
soul_rot
1:16.722 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
1:18.028 havoc R incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.7/5: 14% soul_shard
1:19.766 havoc N conflagrate Fluffy_Pillow 49001.0/50000: 98% mana
1.3/5: 26% soul_shard
1:21.071 aoe F channel_demonfire Fluffy_Pillow 49153.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
1:23.939 aoe G immolate enemy3 49837.5/50000: 100% mana
2.9/5: 58% soul_shard
backdraft
1:25.246 aoe J rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.0/5: 60% soul_shard
backdraft
1:26.552 aoe L incinerate Fluffy_Pillow 49905.5/50000: 100% mana
0.2/5: 4% soul_shard
backdraft
1:27.774 aoe K conflagrate Fluffy_Pillow 49003.5/50000: 98% mana
0.6/5: 12% soul_shard
1:29.081 aoe L incinerate Fluffy_Pillow 49157.0/50000: 98% mana
1.3/5: 26% soul_shard
backdraft
1:30.301 aoe L incinerate Fluffy_Pillow 48767.0/50000: 98% mana
1.6/5: 32% soul_shard
1:32.041 aoe L incinerate Fluffy_Pillow 48637.0/50000: 97% mana
2.1/5: 42% soul_shard
1:33.781 aoe L incinerate Fluffy_Pillow 48507.0/50000: 97% mana
2.6/5: 52% soul_shard
1:35.521 default A cataclysm Fluffy_Pillow 48377.0/50000: 97% mana
3.0/5: 60% soul_shard
1:37.261 default 9 soul_fire Fluffy_Pillow 48747.0/50000: 97% mana
3.3/5: 66% soul_shard
1:40.736 aoe I havoc enemy2 49001.0/50000: 98% mana
4.7/5: 94% soul_shard
1:42.041 havoc Q chaos_bolt Fluffy_Pillow 48653.5/50000: 97% mana
4.7/5: 94% soul_shard
1:44.650 havoc N conflagrate Fluffy_Pillow 49958.0/50000: 100% mana
3.0/5: 60% soul_shard
1:45.958 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft
1:47.784 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
1:49.090 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.6/5: 72% soul_shard
backdraft
1:50.918 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
1:52.224 havoc N conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
1.9/5: 38% soul_shard
1:53.531 aoe F channel_demonfire Fluffy_Pillow 49405.5/50000: 99% mana
3.2/5: 64% soul_shard
backdraft
1:56.356 aoe G immolate enemy3 50000.0/50000: 100% mana
3.5/5: 70% soul_shard
backdraft
1:57.662 aoe J rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
1:58.968 aoe L incinerate Fluffy_Pillow 49905.0/50000: 100% mana
1.0/5: 20% soul_shard
backdraft
2:00.187 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
2:01.928 aoe K conflagrate Fluffy_Pillow 48872.5/50000: 98% mana
1.8/5: 36% soul_shard
2:03.232 aoe L incinerate Fluffy_Pillow 49024.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:04.450 aoe L incinerate Fluffy_Pillow 48633.5/50000: 97% mana
2.9/5: 58% soul_shard
2:06.190 aoe J rain_of_fire Fluffy_Pillow 48503.5/50000: 97% mana
3.4/5: 68% soul_shard
2:07.497 default A cataclysm Fluffy_Pillow 49157.0/50000: 98% mana
0.4/5: 8% soul_shard
2:09.235 aoe E soul_rot Fluffy_Pillow 49501.0/50000: 99% mana
0.9/5: 18% soul_shard
2:10.541 aoe I havoc enemy2 49752.0/50000: 100% mana
0.9/5: 18% soul_shard
soul_rot
2:12.043 havoc N conflagrate Fluffy_Pillow 49503.0/50000: 99% mana
1.2/5: 24% soul_shard
soul_rot
2:13.350 havoc Q chaos_bolt Fluffy_Pillow 49656.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft, soul_rot
2:15.177 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
soul_rot
2:16.918 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.0/5: 20% soul_shard
soul_rot
2:18.657 havoc N conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
1.6/5: 32% soul_shard
2:19.966 havoc P immolate Fluffy_Pillow 49026.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
2:21.275 havoc R incinerate Fluffy_Pillow 48931.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
2:22.494 aoe F channel_demonfire Fluffy_Pillow 48540.5/50000: 97% mana
3.8/5: 76% soul_shard
2:25.356 aoe J rain_of_fire Fluffy_Pillow 49221.5/50000: 98% mana
4.3/5: 86% soul_shard
2:26.662 default 9 soul_fire Fluffy_Pillow 49874.5/50000: 100% mana
1.3/5: 26% soul_shard
2:30.137 aoe G immolate enemy3 49001.0/50000: 98% mana
2.9/5: 58% soul_shard
2:31.444 aoe K conflagrate Fluffy_Pillow 48904.5/50000: 98% mana
2.9/5: 58% soul_shard
2:32.750 aoe J rain_of_fire Fluffy_Pillow 49057.5/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
2:34.056 aoe L incinerate Fluffy_Pillow 49710.5/50000: 99% mana
0.7/5: 14% soul_shard
backdraft
2:35.275 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.0/5: 20% soul_shard
2:36.582 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
2:37.802 aoe L incinerate Fluffy_Pillow 48765.5/50000: 98% mana
2.0/5: 40% soul_shard
2:39.543 default A cataclysm Fluffy_Pillow 48636.0/50000: 97% mana
2.5/5: 50% soul_shard
2:41.282 aoe I havoc enemy2 49005.5/50000: 98% mana
2.8/5: 56% soul_shard
2:42.588 havoc Q chaos_bolt Fluffy_Pillow 48658.5/50000: 97% mana
2.9/5: 58% soul_shard
2:45.200 havoc N conflagrate Fluffy_Pillow 49964.5/50000: 100% mana
1.2/5: 24% soul_shard
2:46.509 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
backdraft
2:48.335 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
2:50.074 havoc R incinerate Fluffy_Pillow 49001.5/50000: 98% mana
1.1/5: 22% soul_shard
2:51.816 havoc P immolate Fluffy_Pillow 48872.5/50000: 98% mana
1.7/5: 34% soul_shard
2:53.122 havoc N conflagrate Fluffy_Pillow 48775.5/50000: 98% mana
1.8/5: 36% soul_shard
2:54.428 aoe F channel_demonfire Fluffy_Pillow 48928.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
2:57.399 aoe J rain_of_fire Fluffy_Pillow 49664.0/50000: 99% mana
3.4/5: 68% soul_shard
backdraft
2:58.704 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft
2:59.924 aoe G immolate enemy3 49002.5/50000: 98% mana
1.0/5: 20% soul_shard
3:01.231 aoe K conflagrate Fluffy_Pillow 48906.0/50000: 98% mana
1.3/5: 26% soul_shard
3:02.538 aoe L incinerate Fluffy_Pillow 49059.5/50000: 98% mana
2.0/5: 40% soul_shard
backdraft
3:03.758 aoe L incinerate Fluffy_Pillow 48669.5/50000: 97% mana
2.4/5: 48% soul_shard
3:05.498 cds M summon_infernal Fluffy_Pillow 48539.5/50000: 97% mana
2.7/5: 54% soul_shard
3:06.804 aoe D rain_of_fire Fluffy_Pillow 48192.5/50000: 96% mana
3.2/5: 64% soul_shard
3:08.111 aoe G immolate enemy2 48846.0/50000: 98% mana
0.5/5: 10% soul_shard
3:09.418 aoe K conflagrate Fluffy_Pillow 48749.5/50000: 97% mana
1.0/5: 20% soul_shard
3:10.955 aoe E soul_rot Fluffy_Pillow 49018.0/50000: 98% mana
1.8/5: 36% soul_shard
backdraft
3:12.261 default A cataclysm Fluffy_Pillow 49421.0/50000: 99% mana
2.5/5: 50% soul_shard
backdraft, soul_rot
3:14.001 aoe I havoc enemy2 49502.0/50000: 99% mana
3.2/5: 64% soul_shard
backdraft, soul_rot
3:15.307 havoc O soul_fire Fluffy_Pillow 49155.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft, soul_rot
3:18.785 havoc Q chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, soul_rot
3:20.613 havoc N conflagrate Fluffy_Pillow 49916.5/50000: 100% mana
3.0/5: 60% soul_shard
3:21.919 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:23.747 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
3:25.488 aoe D rain_of_fire Fluffy_Pillow 49002.5/50000: 98% mana
3.9/5: 78% soul_shard
3:26.795 aoe F channel_demonfire Fluffy_Pillow 49656.0/50000: 99% mana
1.2/5: 24% soul_shard
3:29.662 aoe G immolate enemy2 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
3:30.970 aoe G immolate Fluffy_Pillow 49253.0/50000: 99% mana
2.6/5: 52% soul_shard
3:32.275 aoe D rain_of_fire Fluffy_Pillow 49155.5/50000: 98% mana
3.2/5: 64% soul_shard
3:33.582 aoe G immolate enemy3 49809.0/50000: 100% mana
0.5/5: 10% soul_shard
3:34.887 aoe K conflagrate Fluffy_Pillow 49251.5/50000: 99% mana
1.1/5: 22% soul_shard
3:36.193 aoe L incinerate Fluffy_Pillow 49404.5/50000: 99% mana
1.8/5: 36% soul_shard
backdraft
3:37.412 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.2/5: 44% soul_shard
3:38.718 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
3:39.938 aoe J rain_of_fire Fluffy_Pillow 48765.0/50000: 98% mana
3.1/5: 62% soul_shard
3:41.244 aoe L incinerate Fluffy_Pillow 49418.0/50000: 99% mana
0.3/5: 6% soul_shard
3:42.983 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
0.9/5: 18% soul_shard
3:44.724 default A cataclysm Fluffy_Pillow 48872.0/50000: 98% mana
1.1/5: 22% soul_shard
3:46.464 aoe I havoc enemy2 49242.0/50000: 98% mana
1.4/5: 28% soul_shard
3:47.771 havoc N conflagrate Fluffy_Pillow 48895.5/50000: 98% mana
1.5/5: 30% soul_shard
3:49.079 havoc Q chaos_bolt Fluffy_Pillow 49049.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
3:50.907 havoc R incinerate Fluffy_Pillow 49963.5/50000: 100% mana
1.0/5: 20% soul_shard
3:52.648 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
3:54.200 havoc Q chaos_bolt Fluffy_Pillow 49278.5/50000: 99% mana
2.7/5: 54% soul_shard
backdraft
3:56.026 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
3:57.333 aoe F channel_demonfire Fluffy_Pillow 49252.5/50000: 99% mana
1.1/5: 22% soul_shard
4:00.152 aoe L incinerate Fluffy_Pillow 49912.0/50000: 100% mana
1.4/5: 28% soul_shard
4:01.894 aoe K conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.9/5: 38% soul_shard
4:03.201 aoe L incinerate Fluffy_Pillow 49156.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
4:04.419 default 9 soul_fire Fluffy_Pillow 48765.5/50000: 98% mana
2.9/5: 58% soul_shard
4:07.897 aoe G immolate enemy3 49002.5/50000: 98% mana
4.2/5: 84% soul_shard
4:09.203 aoe J rain_of_fire Fluffy_Pillow 48905.5/50000: 98% mana
4.5/5: 90% soul_shard
4:10.509 aoe K conflagrate Fluffy_Pillow 49558.5/50000: 99% mana
1.5/5: 30% soul_shard
4:11.815 aoe G immolate enemy2 49711.5/50000: 99% mana
2.5/5: 50% soul_shard
backdraft
4:13.120 aoe E soul_rot Fluffy_Pillow 49251.5/50000: 99% mana
2.5/5: 50% soul_shard
backdraft
4:14.426 aoe L incinerate Fluffy_Pillow 49654.5/50000: 99% mana
2.8/5: 56% soul_shard
backdraft, soul_rot
4:15.645 aoe J rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.0/5: 60% soul_shard
soul_rot
4:16.951 default A cataclysm Fluffy_Pillow 49655.0/50000: 99% mana
0.3/5: 6% soul_shard
soul_rot
4:18.691 aoe I havoc enemy2 49502.0/50000: 99% mana
0.3/5: 6% soul_shard
soul_rot
4:19.998 havoc R incinerate Fluffy_Pillow 49155.5/50000: 98% mana
0.6/5: 12% soul_shard
soul_rot
4:21.738 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
soul_rot
4:23.046 havoc Q chaos_bolt Fluffy_Pillow 49156.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
4:24.873 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
4:26.614 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
4:28.356 havoc N conflagrate Fluffy_Pillow 48873.5/50000: 98% mana
1.9/5: 38% soul_shard
4:29.663 havoc P immolate Fluffy_Pillow 49027.0/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
4:30.969 aoe F channel_demonfire Fluffy_Pillow 48930.0/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
4:33.789 aoe G immolate enemy2 49590.0/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
4:35.095 aoe J rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.9/5: 78% soul_shard
backdraft
4:36.401 aoe L incinerate Fluffy_Pillow 49905.0/50000: 100% mana
0.9/5: 18% soul_shard
backdraft
4:37.621 aoe G immolate enemy3 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
4:38.929 aoe K conflagrate Fluffy_Pillow 48906.5/50000: 98% mana
1.4/5: 28% soul_shard
4:40.236 aoe L incinerate Fluffy_Pillow 49060.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
4:41.456 aoe L incinerate Fluffy_Pillow 48670.0/50000: 97% mana
2.5/5: 50% soul_shard
4:43.197 aoe J rain_of_fire Fluffy_Pillow 48540.5/50000: 97% mana
3.0/5: 60% soul_shard
4:44.503 aoe L incinerate Fluffy_Pillow 49193.5/50000: 98% mana
0.0/5: 0% soul_shard
4:46.243 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.6/5: 12% soul_shard
4:47.550 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.1/5: 22% soul_shard
backdraft
4:48.770 default A cataclysm Fluffy_Pillow 48765.5/50000: 98% mana
1.6/5: 32% soul_shard
4:50.511 aoe I havoc enemy2 49136.0/50000: 98% mana
1.9/5: 38% soul_shard
4:51.817 havoc R incinerate Fluffy_Pillow 48789.0/50000: 98% mana
1.9/5: 38% soul_shard
4:53.558 havoc N conflagrate Fluffy_Pillow 48659.5/50000: 97% mana
2.6/5: 52% soul_shard
4:54.864 havoc O soul_fire Fluffy_Pillow 48812.5/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
4:58.342 havoc Q chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
5:00.169 havoc R incinerate Fluffy_Pillow 49916.0/50000: 100% mana
3.0/5: 60% soul_shard
5:01.911 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
3.7/5: 74% soul_shard
5:03.392 aoe F channel_demonfire Fluffy_Pillow 49243.5/50000: 98% mana
4.9/5: 98% soul_shard
backdraft
5:06.229 aoe J rain_of_fire Fluffy_Pillow 49912.0/50000: 100% mana
5.0/5: 100% soul_shard
backdraft
5:07.535 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.0/5: 40% soul_shard
backdraft
5:08.753 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
2.5/5: 50% soul_shard
5:10.492 aoe G immolate enemy3 48871.0/50000: 98% mana
2.7/5: 54% soul_shard
5:11.800 aoe J rain_of_fire Fluffy_Pillow 48775.0/50000: 98% mana
3.1/5: 62% soul_shard
5:13.107 aoe K conflagrate Fluffy_Pillow 49428.5/50000: 99% mana
0.1/5: 2% soul_shard
5:14.413 aoe E soul_rot Fluffy_Pillow 49581.5/50000: 99% mana
0.9/5: 18% soul_shard
backdraft
5:15.729 aoe G immolate Fluffy_Pillow 49752.5/50000: 100% mana
0.9/5: 18% soul_shard
backdraft, soul_rot
5:17.036 aoe G immolate enemy2 49252.5/50000: 99% mana
1.2/5: 24% soul_shard
backdraft, soul_rot
5:18.342 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.2/5: 24% soul_shard
backdraft, soul_rot
5:19.561 aoe K conflagrate Fluffy_Pillow 48765.0/50000: 98% mana
1.8/5: 36% soul_shard
soul_rot
5:20.867 default A cataclysm Fluffy_Pillow 48918.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft, soul_rot
5:22.605 aoe I havoc enemy2 49287.0/50000: 99% mana
2.6/5: 52% soul_shard
backdraft, soul_rot

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="NightFae_Dream"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=night_fae
soulbind=infernal_brand:6/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

NightFae_Dream_SB : 9794 dps, 5258 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9793.6 9793.6 17.2 / 0.176% 799.0 / 8.2% 21.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
388.9 386.3 Mana 0.00% 38.5 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Dream_SB 9794
Cataclysm 787 8.0% 9.7 32.34sec 24296 14299 Direct 29.0 6807 13613 8103 19.0%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.68 29.05 0.00 0.00 1.6992 0.0000 235265.90 235265.90 0.00% 14299.27 14299.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.01% 23.53 15 34 6806.82 6142 7454 6807.02 6614 7066 160190 160190 0.00%
crit 18.99% 5.52 0 13 13613.46 12283 14905 13590.35 0 14494 75076 75076 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.74
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1037) 0.0% (10.6%) 12.0 25.70sec 25839 9599

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.99 0.00 179.07 0.00 2.6918 0.1634 0.00 0.00 0.00% 9599.24 9599.24

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [F]:11.99
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1037 10.6% 0.0 0.00sec 0 0 Direct 537.2 483 968 577 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 537.21 0.00 0.00 0.0000 0.0000 309863.61 309863.61 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 433.34 313 598 483.04 263 1002 483.34 454 508 209300 209300 0.00%
crit 19.34% 103.88 60 146 968.12 525 2004 968.22 831 1142 100564 100564 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1317 (1774) 13.4% (18.1%) 21.5 13.66sec 24570 12552 Direct 42.9 (85.4) 0 9169 9169 100.0% (59.9%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.55 42.87 0.00 0.00 1.9575 0.0000 393071.12 393071.12 0.00% 12551.95 12551.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 42.87 32 60 9168.67 5862 12567 9168.14 8954 9401 393071 393071 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:21.68
  • if_expr:cast_time<havoc_remains
    Internal Combustion 457 4.7% 42.5 13.65sec 3206 0 Direct 42.5 2683 5367 3208 19.5%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.53 42.53 0.00 0.00 0.0000 0.0000 136382.55 136382.55 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.48% 34.23 20 54 2682.64 1 3916 2686.03 2479 2910 91841 91841 0.00%
crit 19.52% 8.30 1 18 5366.64 199 7817 5370.77 3920 6923 44542 44542 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 818 8.4% 36.8 7.96sec 6635 5306 Direct 56.5 3636 7264 4321 18.9%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.83 56.53 0.00 0.00 1.2505 0.0000 244330.78 244330.78 0.00% 5305.66 5305.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.09% 45.85 30 59 3635.94 2047 5177 3636.30 3410 3888 166678 166678 0.00%
crit 18.91% 10.69 2 19 7264.40 4096 10353 7267.80 4784 9225 77653 77653 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:17.12
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.71
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1629 16.7% 26.6 10.99sec 18340 14540 Direct 33.7 1551 3102 1855 19.6%
Periodic 346.3 1027 2053 1225 19.3% 95.9%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.56 33.73 346.32 346.32 1.2613 2.4832 487013.93 487013.93 0.00% 545.09 14540.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.39% 27.12 17 40 1551.07 819 2071 1551.63 1398 1683 42051 42051 0.00%
crit 19.61% 6.61 0 14 3101.82 1645 4141 3098.79 0 3955 20502 20502 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.65% 279.30 206 360 1027.06 0 1294 1027.20 1007 1048 286883 286883 0.00%
crit 19.35% 67.01 40 101 2052.68 1 2588 2053.72 1961 2146 137578 137578 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [G]:17.90
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.77
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 625 6.4% 44.7 6.03sec 4186 2857 Direct 55.3 (55.3) 2831 5661 3379 19.4% (19.4%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.66 55.32 0.00 0.00 1.4651 0.0000 186921.70 186921.70 0.00% 2856.86 2856.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.62% 44.60 25 69 2830.59 1318 3517 2831.84 2670 3021 126221 126221 0.00%
crit 19.38% 10.72 1 22 5660.76 2724 7034 5663.22 4221 6640 60701 60701 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:33.85
    havoc
    [R]:11.04
  • if_expr:cast_time<havoc_remains
Rain of Fire 931 9.5% 17.5 16.09sec 15865 12722 Periodic 415.6 560 1121 669 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.52 0.00 0.00 415.56 1.2470 0.0000 277933.54 277933.54 0.00% 12722.40 12722.40
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.65% 335.15 228 462 560.38 507 615 560.39 553 568 187813 187813 0.00%
crit 19.35% 80.41 46 120 1120.78 1013 1230 1120.81 1099 1144 90121 90121 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.34
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [J]:12.17
Soul Fire 519 5.3% 5.5 49.47sec 27999 8052 Direct 7.8 16476 33107 19776 20.0%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.53 7.81 0.00 0.00 3.4775 0.0000 154868.49 154868.49 0.00% 8051.81 8051.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.98% 6.25 2 11 16476.12 8605 21739 16539.11 13175 19704 103007 103007 0.00%
crit 20.02% 1.56 0 6 33107.06 17222 43436 27510.99 0 43436 51862 51862 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.25
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.37
  • if_expr:cast_time<havoc_remains
Soul Rot 344 3.5% 5.3 62.55sec 19531 15632 Periodic 96.6 895 1786 1066 19.2% 13.9%

Stats Details: Soul Rot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.27 0.00 96.61 96.61 1.2496 1.2896 102934.48 102934.48 0.00% 784.73 15631.66
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.82% 78.08 52 101 894.55 424 1432 894.93 832 948 69859 69859 0.00%
crit 19.18% 18.53 8 33 1786.27 849 2865 1784.15 1359 2277 33076 33076 0.00%

Action Details: Soul Rot

  • id:325640
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • harmful:true

Resources

  • resource:mana
  • base_cost:250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:325640
  • name:Soul Rot
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.

Action Priority List

    aoe
    [E]:5.28
Summon Infernal 82 0.8% 2.0 180.49sec 12048 10418 Direct 6.0 3378 6754 4013 18.9%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24096.00 24096.00 0.00% 10417.64 10417.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.12% 4.87 1 6 3378.50 3348 3437 3378.23 3348 3437 16445 16445 0.00%
crit 18.88% 1.13 0 5 6754.06 6696 6875 4756.84 0 6875 7651 7651 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3563 / 724
Immolation 3294 6.8% 39.0 5.49sec 5068 0 Direct 117.0 1414 2828 1689 19.5%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 197648.27 197648.27 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.55% 94.24 80 107 1414.21 1395 1432 1414.21 1411 1417 133277 133277 0.00%
crit 19.45% 22.76 10 37 2828.42 2790 2865 2828.46 2807 2853 64371 64371 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 269 0.6% 41.0 5.25sec 393 274 Direct 41.0 330 660 394 19.3%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 16132.99 23044.37 29.99% 273.89 273.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 33.10 26 39 329.97 326 334 329.97 329 331 10923 15602 29.99%
crit 19.26% 7.90 2 15 659.73 651 668 659.77 651 668 5210 7442 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 523 / 523
Firebolt 523 5.4% 93.0 3.22sec 1681 1155 Direct 92.3 1414 2828 1695 19.8%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.02 92.30 0.00 0.00 1.4558 0.0000 156400.64 156400.64 0.00% 1154.91 1154.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.18% 74.00 55 96 1414.08 1395 1432 1414.12 1411 1418 104648 104648 0.00%
crit 19.82% 18.30 5 31 2828.48 2790 2865 2828.40 2803 2858 51752 51752 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.47
Simple Action Stats Execute Interval
NightFae_Dream_SB
Havoc 9.6 32.05sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.63 0.00 0.00 0.00 1.2442 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [I]:9.64
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.8 0.0 8.0sec 8.0sec 4.1sec 50.55% 0.00% 0.0 (0.0) 1.5

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 24.1s
  • trigger_min/max:2.1s / 24.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:50.55%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.56% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.56%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Social Butterfly 30.4 0.0 10.0sec 10.0sec 5.0sec 50.41% 0.00% 0.0 (0.0) 29.9

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_social_butterfly
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 10.0s
  • trigger_min/max:10.0s / 10.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.0s

Stack Uptimes

  • social_butterfly_1:50.41%

Spelldata

  • id:320130
  • name:Social Butterfly
  • tooltip:Versatility increased by $w1%.
  • description:{$@spelldesc319210=When at least {$s3=2} allies are within {$s4=8} yd, your Versatility increases by {$320130s1=3}% for {$320130d=5 seconds}. When this expires, {$s3=2} nearby allies gain ${{$320212s1=1}/{$320130s1=3}*100}% of this effect for {$320212d=5 seconds} before passing it back to you.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Soul Rot 5.3 0.0 62.4sec 62.4sec 7.9sec 13.92% 0.00% 0.0 (0.0) 5.1

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_soul_rot
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:61.3s / 68.5s
  • trigger_min/max:61.3s / 68.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • soul_rot_1:13.92%

Spelldata

  • id:325640
  • name:Soul Rot
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 185.0s
  • trigger_min/max:180.0s / 185.0s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 185.0s
  • trigger_min/max:180.0s / 185.0s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.17% 10.71% 17.53% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Dream_SB
soul_fire Soul Shard 6.54 7.14 7.52% 1.09 0.75 9.50%
immolate Soul Shard 346.33 33.50 35.29% 0.10 1.14 3.28%
incinerate Soul Shard 44.66 11.12 11.71% 0.25 0.01 0.08%
conflagrate Soul Shard 36.82 28.27 29.78% 0.77 0.00 0.00%
mana_regen Mana 657.90 115551.88 100.00% 175.64 33687.65 22.57%
immolate_crits Soul Shard 33.47 3.24 3.41% 0.10 0.11 3.19%
incinerate_crits Soul Shard 10.73 1.07 1.13% 0.10 0.00 0.06%
infernal Soul Shard 120.00 10.59 11.15% 0.09 1.41 11.77%
pet - imp
energy_regen Energy 360.02 3550.34 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 386.33 388.92 33699.1 49225.9 47938.5 50000.0
Soul Shard 4.0 0.32 0.32 3.4 2.3 0.0 5.0
Usage Type Count Total Avg RPE APR
NightFae_Dream_SB
cataclysm Mana 9.7 4845.6 500.0 500.4 48.6
channel_demonfire Mana 12.0 8991.8 750.0 749.8 34.5
chaos_bolt Soul Shard 21.5 43.1 2.0 2.0 12285.7
conflagrate Mana 36.8 18410.3 500.0 499.9 13.3
havoc Mana 9.6 9639.6 1000.0 1000.6 0.0
immolate Mana 26.6 19918.9 750.0 750.1 24.4
incinerate Mana 44.7 44663.0 1000.0 1000.1 4.2
rain_of_fire Soul Shard 17.5 52.5 3.0 3.0 5290.4
soul_fire Mana 6.5 6538.2 1000.0 1182.1 23.7
soul_rot Mana 5.3 1315.9 250.0 249.7 78.2
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 93.0 3720.9 40.0 40.0 42.0

Statistics & Data Analysis

Fight Length
NightFae_Dream_SB Fight Length
Count 625
Mean 299.05
Minimum 240.24
Maximum 359.94
Spread ( max - min ) 119.70
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
NightFae_Dream_SB Damage Per Second
Count 625
Mean 9793.62
Minimum 9243.90
Maximum 10444.66
Spread ( max - min ) 1200.77
Range [ ( max - min ) / 2 * 100% ] 6.13%
Standard Deviation 219.4112
5th Percentile 9466.43
95th Percentile 10181.36
( 95th Percentile - 5th Percentile ) 714.93
Mean Distribution
Standard Deviation 8.7764
95.00% Confidence Interval ( 9776.42 - 9810.82 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1929
0.1 Scale Factor Error with Delta=300 411
0.05 Scale Factor Error with Delta=300 1644
0.01 Scale Factor Error with Delta=300 41097
Priority Target DPS
NightFae_Dream_SB Priority Target Damage Per Second
Count 625
Mean 5258.27
Minimum 4910.75
Maximum 5619.76
Spread ( max - min ) 709.00
Range [ ( max - min ) / 2 * 100% ] 6.74%
Standard Deviation 126.9210
5th Percentile 5071.33
95th Percentile 5472.56
( 95th Percentile - 5th Percentile ) 401.23
Mean Distribution
Standard Deviation 5.0768
95.00% Confidence Interval ( 5248.32 - 5268.22 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2239
0.1 Scale Factor Error with Delta=300 138
0.05 Scale Factor Error with Delta=300 551
0.01 Scale Factor Error with Delta=300 13752
DPS(e)
NightFae_Dream_SB Damage Per Second (Effective)
Count 625
Mean 9793.62
Minimum 9243.90
Maximum 10444.66
Spread ( max - min ) 1200.77
Range [ ( max - min ) / 2 * 100% ] 6.13%
Damage
NightFae_Dream_SB Damage
Count 625
Mean 2552682.10
Minimum 2037155.43
Maximum 3098218.05
Spread ( max - min ) 1061062.63
Range [ ( max - min ) / 2 * 100% ] 20.78%
DTPS
NightFae_Dream_SB Damage Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Dream_SB Healing Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Dream_SB Healing Per Second (Effective)
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Dream_SB Heal
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Dream_SB Healing Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Dream_SB Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_Dream_SBTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Dream_SB Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.25 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.74 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.34 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
E 5.28 soul_rot
F 11.99 channel_demonfire,if=dot.immolate.remains>cast_time
G 17.90 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
H 0.00 call_action_list,name=cds
I 9.64 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
J 12.17 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 17.12 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 33.85 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.71 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.37 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.77 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 21.68 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 11.04 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEFMIQNQNPQNQNDFGGDGLKLLDKALLJFINQRNOPJLGKJLFKLAELJIRNQRNPRFGJKLLLJ9AKIQNQRRPFKLJGLKLLLELAINQQNPQ9FGGKJLKLLLAINQQRNPFJLLGKMLLDE9AFIQNQNPQNDLLGGFGJKLAKIQNQRRPN9FGJEKLJLKAIQRRNQPFLKLLGGJKGLL9AFIQNQNPQNJELGLFG

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
social_butterfly
0:01.740 aoe E soul_rot Fluffy_Pillow 49370.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, social_butterfly
0:02.748 aoe F channel_demonfire Fluffy_Pillow 49624.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, soul_rot, social_butterfly
0:05.054 cds M summon_infernal Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, soul_rot
0:06.060 aoe I havoc enemy2 49503.0/50000: 99% mana
4.8/5: 96% soul_shard
bloodlust, soul_rot
0:07.066 havoc Q chaos_bolt Fluffy_Pillow 49006.0/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust, soul_rot
0:09.077 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, soul_rot
0:10.085 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, soul_rot, social_butterfly
0:11.492 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust, social_butterfly
0:12.499 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft, social_butterfly
0:13.507 havoc Q chaos_bolt Fluffy_Pillow 49253.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, social_butterfly
0:14.915 havoc N conflagrate Fluffy_Pillow 49957.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, social_butterfly
0:15.921 havoc Q chaos_bolt Fluffy_Pillow 49960.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:17.329 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:18.336 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:19.344 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
bloodlust, backdraft
0:21.721 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
bloodlust, backdraft, social_butterfly
0:22.727 aoe G immolate enemy2 49252.0/50000: 99% mana
2.8/5: 56% soul_shard
bloodlust, backdraft, social_butterfly
0:23.734 aoe D rain_of_fire Fluffy_Pillow 49005.5/50000: 98% mana
3.1/5: 62% soul_shard
bloodlust, backdraft, social_butterfly
0:24.739 aoe G immolate enemy3 49508.0/50000: 99% mana
0.3/5: 6% soul_shard
bloodlust, backdraft, social_butterfly
0:25.745 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.7/5: 14% soul_shard
bloodlust, backdraft
0:26.685 aoe K conflagrate Fluffy_Pillow 48722.0/50000: 97% mana
1.1/5: 22% soul_shard
bloodlust
0:27.692 aoe L incinerate Fluffy_Pillow 48725.5/50000: 97% mana
1.8/5: 36% soul_shard
bloodlust, backdraft
0:28.632 aoe L incinerate Fluffy_Pillow 48195.5/50000: 96% mana
2.8/5: 56% soul_shard
bloodlust
0:29.973 aoe D rain_of_fire Fluffy_Pillow 47866.0/50000: 96% mana
3.5/5: 70% soul_shard
bloodlust
0:30.980 aoe K conflagrate Fluffy_Pillow 48369.5/50000: 97% mana
0.7/5: 14% soul_shard
bloodlust, social_butterfly
0:31.987 default A cataclysm Fluffy_Pillow 48373.0/50000: 97% mana
1.7/5: 34% soul_shard
bloodlust, backdraft, social_butterfly
0:33.326 aoe L incinerate Fluffy_Pillow 48542.5/50000: 97% mana
2.0/5: 40% soul_shard
bloodlust, backdraft, social_butterfly
0:34.266 aoe L incinerate Fluffy_Pillow 48012.5/50000: 96% mana
2.8/5: 56% soul_shard
bloodlust, social_butterfly
0:35.606 aoe J rain_of_fire Fluffy_Pillow 47682.5/50000: 95% mana
3.2/5: 64% soul_shard
bloodlust
0:36.614 aoe F channel_demonfire Fluffy_Pillow 48186.5/50000: 96% mana
0.7/5: 14% soul_shard
bloodlust
0:38.885 aoe I havoc enemy2 48572.0/50000: 97% mana
1.1/5: 22% soul_shard
bloodlust
0:39.890 havoc N conflagrate Fluffy_Pillow 48074.5/50000: 96% mana
1.4/5: 28% soul_shard
bloodlust
0:40.895 havoc Q chaos_bolt Fluffy_Pillow 48077.0/50000: 96% mana
2.4/5: 48% soul_shard
bloodlust, backdraft, social_butterfly
0:42.301 havoc R incinerate Fluffy_Pillow 48780.0/50000: 98% mana
0.7/5: 14% soul_shard
social_butterfly
0:44.042 havoc N conflagrate Fluffy_Pillow 48650.5/50000: 97% mana
1.1/5: 22% soul_shard
social_butterfly
0:45.349 havoc O soul_fire Fluffy_Pillow 48804.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
0:48.826 havoc P immolate Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:50.132 aoe J rain_of_fire Fluffy_Pillow 48905.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, social_butterfly
0:51.437 aoe L incinerate Fluffy_Pillow 49557.5/50000: 99% mana
2.0/5: 40% soul_shard
backdraft, social_butterfly
0:52.657 aoe G immolate enemy3 49002.5/50000: 98% mana
2.6/5: 52% soul_shard
social_butterfly
0:53.965 aoe K conflagrate Fluffy_Pillow 48906.5/50000: 98% mana
2.6/5: 52% soul_shard
social_butterfly
0:55.272 aoe J rain_of_fire Fluffy_Pillow 49060.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
0:56.577 aoe L incinerate Fluffy_Pillow 49712.5/50000: 99% mana
0.4/5: 8% soul_shard
backdraft
0:57.797 aoe F channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
1:00.698 aoe K conflagrate Fluffy_Pillow 49703.0/50000: 99% mana
1.4/5: 28% soul_shard
social_butterfly
1:02.004 aoe L incinerate Fluffy_Pillow 49856.0/50000: 100% mana
1.9/5: 38% soul_shard
backdraft, social_butterfly
1:03.223 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
social_butterfly
1:05.064 aoe E soul_rot Fluffy_Pillow 49422.5/50000: 99% mana
2.6/5: 52% soul_shard
1:06.371 aoe L incinerate Fluffy_Pillow 49752.5/50000: 100% mana
2.9/5: 58% soul_shard
soul_rot
1:08.111 aoe J rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.4/5: 68% soul_shard
soul_rot
1:09.416 aoe I havoc enemy2 49654.5/50000: 99% mana
0.4/5: 8% soul_shard
soul_rot
1:10.723 havoc R incinerate Fluffy_Pillow 49308.0/50000: 99% mana
0.9/5: 18% soul_shard
soul_rot, social_butterfly
1:12.464 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
soul_rot, social_butterfly
1:13.770 havoc Q chaos_bolt Fluffy_Pillow 49155.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft, soul_rot, social_butterfly
1:15.597 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
1:17.338 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
1:18.646 havoc P immolate Fluffy_Pillow 49156.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
1:19.950 havoc R incinerate Fluffy_Pillow 49058.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
1:21.171 aoe F channel_demonfire Fluffy_Pillow 48669.0/50000: 97% mana
3.5/5: 70% soul_shard
social_butterfly
1:23.958 aoe G immolate enemy3 49312.5/50000: 99% mana
3.9/5: 78% soul_shard
social_butterfly
1:25.264 aoe J rain_of_fire Fluffy_Pillow 49215.5/50000: 98% mana
3.9/5: 78% soul_shard
1:26.570 aoe K conflagrate Fluffy_Pillow 49868.5/50000: 100% mana
1.2/5: 24% soul_shard
1:27.877 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
backdraft
1:29.095 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
2.2/5: 44% soul_shard
1:30.836 aoe L incinerate Fluffy_Pillow 48872.0/50000: 98% mana
2.4/5: 48% soul_shard
social_butterfly
1:32.577 aoe J rain_of_fire Fluffy_Pillow 48742.5/50000: 97% mana
3.1/5: 62% soul_shard
social_butterfly
1:33.884 default 9 soul_fire Fluffy_Pillow 49396.0/50000: 99% mana
0.4/5: 8% soul_shard
social_butterfly
1:37.361 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
1.8/5: 36% soul_shard
1:39.101 aoe K conflagrate Fluffy_Pillow 49372.0/50000: 99% mana
2.1/5: 42% soul_shard
1:40.407 aoe I havoc enemy2 49525.0/50000: 99% mana
2.6/5: 52% soul_shard
backdraft, social_butterfly
1:41.714 havoc Q chaos_bolt Fluffy_Pillow 49178.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft, social_butterfly
1:43.542 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
social_butterfly
1:44.847 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
backdraft, social_butterfly
1:46.675 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
1:48.416 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
1:50.156 havoc P immolate Fluffy_Pillow 48872.5/50000: 98% mana
1.8/5: 36% soul_shard
social_butterfly
1:51.462 aoe F channel_demonfire Fluffy_Pillow 48775.5/50000: 98% mana
1.8/5: 36% soul_shard
social_butterfly
1:54.157 aoe K conflagrate Fluffy_Pillow 49373.0/50000: 99% mana
2.1/5: 42% soul_shard
social_butterfly
1:55.463 aoe L incinerate Fluffy_Pillow 49526.0/50000: 99% mana
2.8/5: 56% soul_shard
backdraft
1:56.684 aoe J rain_of_fire Fluffy_Pillow 49003.0/50000: 98% mana
3.1/5: 62% soul_shard
1:57.992 aoe G immolate enemy3 49657.0/50000: 99% mana
0.3/5: 6% soul_shard
1:59.300 aoe L incinerate Fluffy_Pillow 49253.0/50000: 99% mana
0.4/5: 8% soul_shard
2:01.040 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
social_butterfly
2:02.347 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.5/5: 30% soul_shard
backdraft, social_butterfly
2:03.566 aoe L incinerate Fluffy_Pillow 48765.0/50000: 98% mana
1.9/5: 38% soul_shard
social_butterfly
2:05.306 aoe L incinerate Fluffy_Pillow 48635.0/50000: 97% mana
2.4/5: 48% soul_shard
2:07.045 aoe E soul_rot Fluffy_Pillow 48504.5/50000: 97% mana
2.6/5: 52% soul_shard
2:08.352 aoe L incinerate Fluffy_Pillow 48908.0/50000: 98% mana
2.9/5: 58% soul_shard
soul_rot
2:10.093 default A cataclysm Fluffy_Pillow 48778.5/50000: 98% mana
3.2/5: 64% soul_shard
soul_rot, social_butterfly
2:11.834 aoe I havoc enemy2 49149.0/50000: 98% mana
3.5/5: 70% soul_shard
soul_rot, social_butterfly
2:13.143 havoc N conflagrate Fluffy_Pillow 48803.5/50000: 98% mana
3.6/5: 72% soul_shard
soul_rot, social_butterfly
2:14.449 havoc Q chaos_bolt Fluffy_Pillow 48956.5/50000: 98% mana
4.8/5: 96% soul_shard
backdraft, soul_rot, social_butterfly
2:16.278 havoc Q chaos_bolt Fluffy_Pillow 49871.0/50000: 100% mana
2.9/5: 58% soul_shard
soul_rot
2:18.889 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
2:20.196 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
backdraft, social_butterfly
2:21.505 havoc Q chaos_bolt Fluffy_Pillow 49253.5/50000: 99% mana
2.6/5: 52% soul_shard
backdraft, social_butterfly
2:23.333 default 9 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
social_butterfly
2:26.811 aoe F channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
2.3/5: 46% soul_shard
2:29.637 aoe G immolate enemy2 49665.5/50000: 99% mana
2.6/5: 52% soul_shard
2:30.943 aoe G immolate enemy3 49252.0/50000: 99% mana
2.6/5: 52% soul_shard
social_butterfly
2:32.248 aoe K conflagrate Fluffy_Pillow 49154.5/50000: 98% mana
2.9/5: 58% soul_shard
social_butterfly
2:33.554 aoe J rain_of_fire Fluffy_Pillow 49307.5/50000: 99% mana
3.4/5: 68% soul_shard
backdraft, social_butterfly
2:34.860 aoe L incinerate Fluffy_Pillow 49960.5/50000: 100% mana
0.7/5: 14% soul_shard
backdraft, social_butterfly
2:36.079 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
2:37.385 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
2:38.604 aoe L incinerate Fluffy_Pillow 48764.5/50000: 98% mana
1.9/5: 38% soul_shard
2:40.346 aoe L incinerate Fluffy_Pillow 48635.5/50000: 97% mana
2.4/5: 48% soul_shard
social_butterfly
2:42.087 default A cataclysm Fluffy_Pillow 48506.0/50000: 97% mana
2.8/5: 56% soul_shard
social_butterfly
2:43.827 aoe I havoc enemy2 48876.0/50000: 98% mana
3.1/5: 62% soul_shard
social_butterfly
2:45.133 havoc N conflagrate Fluffy_Pillow 48529.0/50000: 97% mana
3.4/5: 68% soul_shard
2:46.438 havoc Q chaos_bolt Fluffy_Pillow 48681.5/50000: 97% mana
4.4/5: 88% soul_shard
backdraft
2:48.265 havoc Q chaos_bolt Fluffy_Pillow 49595.0/50000: 99% mana
2.7/5: 54% soul_shard
2:50.875 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
social_butterfly
2:52.615 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
social_butterfly
2:53.921 havoc P immolate Fluffy_Pillow 49155.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft, social_butterfly
2:55.229 aoe F channel_demonfire Fluffy_Pillow 49059.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
2:58.150 aoe J rain_of_fire Fluffy_Pillow 49769.5/50000: 100% mana
3.4/5: 68% soul_shard
backdraft
2:59.457 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
backdraft
3:00.677 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
0.9/5: 18% soul_shard
social_butterfly
3:02.417 aoe G immolate enemy3 48872.5/50000: 98% mana
1.1/5: 22% soul_shard
social_butterfly
3:03.724 aoe K conflagrate Fluffy_Pillow 48776.0/50000: 98% mana
1.4/5: 28% soul_shard
social_butterfly
3:05.031 cds M summon_infernal Fluffy_Pillow 48929.5/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
3:06.362 aoe L incinerate Fluffy_Pillow 48595.0/50000: 97% mana
2.4/5: 48% soul_shard
backdraft
3:07.581 aoe L incinerate Fluffy_Pillow 48204.5/50000: 96% mana
2.9/5: 58% soul_shard
3:09.322 aoe D rain_of_fire Fluffy_Pillow 48075.0/50000: 96% mana
3.7/5: 74% soul_shard
3:10.630 aoe E soul_rot Fluffy_Pillow 48729.0/50000: 97% mana
1.2/5: 24% soul_shard
social_butterfly
3:11.937 default 9 soul_fire Fluffy_Pillow 49132.5/50000: 98% mana
1.6/5: 32% soul_shard
soul_rot, social_butterfly
3:15.416 default A cataclysm Fluffy_Pillow 49003.0/50000: 98% mana
3.8/5: 76% soul_shard
soul_rot
3:17.156 aoe F channel_demonfire Fluffy_Pillow 49373.0/50000: 99% mana
4.3/5: 86% soul_shard
soul_rot
3:19.968 aoe I havoc enemy2 50000.0/50000: 100% mana
5.0/5: 100% soul_shard
3:21.275 havoc Q chaos_bolt Fluffy_Pillow 49653.5/50000: 99% mana
5.0/5: 100% soul_shard
social_butterfly
3:23.885 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
social_butterfly
3:25.191 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:27.019 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
3:28.325 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft
3:29.632 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.8/5: 96% soul_shard
backdraft
3:31.461 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
social_butterfly
3:32.767 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft, social_butterfly
3:34.074 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
backdraft, social_butterfly
3:35.293 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.4/5: 48% soul_shard
3:37.034 aoe G immolate enemy3 48872.5/50000: 98% mana
2.9/5: 58% soul_shard
3:38.342 aoe G immolate enemy2 48776.5/50000: 98% mana
3.1/5: 62% soul_shard
3:39.648 aoe F channel_demonfire Fluffy_Pillow 48679.5/50000: 97% mana
3.3/5: 66% soul_shard
3:42.471 aoe G immolate Fluffy_Pillow 49341.0/50000: 99% mana
3.6/5: 72% soul_shard
social_butterfly
3:43.777 aoe J rain_of_fire Fluffy_Pillow 49244.0/50000: 98% mana
3.9/5: 78% soul_shard
social_butterfly
3:45.084 aoe K conflagrate Fluffy_Pillow 49897.5/50000: 100% mana
1.0/5: 20% soul_shard
3:46.389 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
backdraft
3:47.609 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
2.0/5: 40% soul_shard
3:49.350 aoe K conflagrate Fluffy_Pillow 49373.0/50000: 99% mana
2.3/5: 46% soul_shard
3:50.656 aoe I havoc enemy2 49526.0/50000: 99% mana
2.9/5: 58% soul_shard
backdraft, social_butterfly
3:51.964 havoc Q chaos_bolt Fluffy_Pillow 49180.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft, social_butterfly
3:53.791 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
social_butterfly
3:55.097 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
backdraft
3:56.925 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
3:58.664 havoc R incinerate Fluffy_Pillow 49001.5/50000: 98% mana
1.3/5: 26% soul_shard
4:00.406 havoc P immolate Fluffy_Pillow 48872.5/50000: 98% mana
1.9/5: 38% soul_shard
social_butterfly
4:01.715 havoc N conflagrate Fluffy_Pillow 48777.0/50000: 98% mana
2.0/5: 40% soul_shard
social_butterfly
4:03.020 default 9 soul_fire Fluffy_Pillow 48929.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft, social_butterfly
4:06.496 aoe F channel_demonfire Fluffy_Pillow 49001.5/50000: 98% mana
4.6/5: 92% soul_shard
backdraft
4:09.356 aoe G immolate enemy3 49681.5/50000: 99% mana
4.9/5: 98% soul_shard
backdraft
4:10.663 aoe J rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
5.0/5: 100% soul_shard
backdraft, social_butterfly
4:11.968 aoe E soul_rot Fluffy_Pillow 49905.0/50000: 100% mana
2.1/5: 42% soul_shard
social_butterfly
4:13.273 aoe K conflagrate Fluffy_Pillow 49751.5/50000: 100% mana
2.3/5: 46% soul_shard
soul_rot, social_butterfly
4:14.581 aoe L incinerate Fluffy_Pillow 49905.5/50000: 100% mana
2.9/5: 58% soul_shard
backdraft, soul_rot, social_butterfly
4:15.800 aoe J rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.4/5: 68% soul_shard
soul_rot
4:17.105 aoe L incinerate Fluffy_Pillow 49654.5/50000: 99% mana
0.5/5: 10% soul_shard
soul_rot
4:18.846 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.9/5: 18% soul_shard
soul_rot
4:20.275 default A cataclysm Fluffy_Pillow 49217.0/50000: 98% mana
1.6/5: 32% soul_shard
backdraft, soul_rot, social_butterfly
4:22.014 aoe I havoc enemy2 49501.5/50000: 99% mana
1.8/5: 36% soul_shard
backdraft, social_butterfly
4:23.321 havoc Q chaos_bolt Fluffy_Pillow 49155.0/50000: 98% mana
2.0/5: 40% soul_shard
backdraft, social_butterfly
4:25.149 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.1/5: 2% soul_shard
4:26.890 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
0.7/5: 14% soul_shard
4:28.629 havoc N conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
1.5/5: 30% soul_shard
4:29.935 havoc Q chaos_bolt Fluffy_Pillow 49025.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
4:31.763 havoc P immolate Fluffy_Pillow 49939.0/50000: 100% mana
0.9/5: 18% soul_shard
social_butterfly
4:33.069 aoe F channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
1.0/5: 20% soul_shard
social_butterfly
4:35.868 aoe L incinerate Fluffy_Pillow 49901.5/50000: 100% mana
1.3/5: 26% soul_shard
4:37.609 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.7/5: 34% soul_shard
4:38.915 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
4:40.134 aoe L incinerate Fluffy_Pillow 48765.0/50000: 98% mana
2.8/5: 56% soul_shard
social_butterfly
4:41.874 aoe G immolate enemy3 48635.0/50000: 97% mana
3.3/5: 66% soul_shard
social_butterfly
4:43.181 aoe G immolate enemy2 48538.5/50000: 97% mana
3.4/5: 68% soul_shard
social_butterfly
4:44.486 aoe J rain_of_fire Fluffy_Pillow 48441.0/50000: 97% mana
3.6/5: 72% soul_shard
social_butterfly
4:45.792 aoe K conflagrate Fluffy_Pillow 49094.0/50000: 98% mana
0.7/5: 14% soul_shard
4:47.098 aoe G immolate Fluffy_Pillow 49247.0/50000: 98% mana
1.4/5: 28% soul_shard
backdraft
4:48.405 aoe L incinerate Fluffy_Pillow 49150.5/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
4:49.625 aoe L incinerate Fluffy_Pillow 48760.5/50000: 98% mana
2.0/5: 40% soul_shard
4:51.365 default 9 soul_fire Fluffy_Pillow 48630.5/50000: 97% mana
2.3/5: 46% soul_shard
social_butterfly
4:54.971 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
3.9/5: 78% soul_shard
social_butterfly
4:56.711 aoe F channel_demonfire Fluffy_Pillow 49372.5/50000: 99% mana
4.1/5: 82% soul_shard
4:59.541 aoe I havoc enemy2 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
5:00.846 havoc Q chaos_bolt Fluffy_Pillow 49652.5/50000: 99% mana
4.7/5: 94% soul_shard
social_butterfly
5:03.455 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
social_butterfly
5:04.762 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
backdraft, social_butterfly
5:06.589 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
5:07.896 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.6/5: 72% soul_shard
backdraft
5:09.203 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
3.7/5: 74% soul_shard
backdraft
5:11.030 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.0/5: 40% soul_shard
social_butterfly
5:12.336 aoe J rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.1/5: 62% soul_shard
backdraft, social_butterfly
5:13.643 aoe E soul_rot Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
backdraft, social_butterfly
5:14.950 aoe L incinerate Fluffy_Pillow 49752.5/50000: 100% mana
0.5/5: 10% soul_shard
backdraft, soul_rot, social_butterfly
5:16.170 aoe G immolate enemy3 49002.5/50000: 98% mana
0.8/5: 16% soul_shard
soul_rot
5:17.476 aoe L incinerate Fluffy_Pillow 48905.5/50000: 98% mana
0.9/5: 18% soul_shard
soul_rot
5:19.215 aoe F channel_demonfire Fluffy_Pillow 48775.0/50000: 98% mana
1.3/5: 26% soul_shard
soul_rot
5:21.978 aoe G immolate Fluffy_Pillow 49406.5/50000: 99% mana
1.7/5: 34% soul_shard
soul_rot, social_butterfly

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="NightFae_Dream_SB"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=night_fae
soulbind=319210/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

NightFae_Koraylon : 9929 dps, 5328 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9929.3 9929.3 17.5 / 0.176% 845.4 / 8.5% 22.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
388.5 385.9 Mana 0.00% 38.5 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Koraylon 9929
Cataclysm 799 8.1% 9.7 32.36sec 24628 14494 Direct 29.1 6893 13795 8208 19.1%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.69 29.07 0.00 0.00 1.6992 0.0000 238672.19 238672.19 0.00% 14493.97 14493.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.91% 23.52 14 32 6892.63 6142 7987 6893.05 6677 7139 162140 162140 0.00%
crit 19.09% 5.55 1 12 13795.17 12285 15973 13788.21 12588 15780 76532 76532 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.76
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1059) 0.0% (10.7%) 12.0 25.60sec 26312 9778

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.02 0.00 179.35 0.00 2.6909 0.1633 0.00 0.00 0.00% 9778.05 9778.05

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [F]:12.02
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1059 10.7% 0.0 0.00sec 0 0 Direct 538.0 492 985 587 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 538.05 0.00 0.00 0.0000 0.0000 316163.31 316163.31 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 434.15 316 574 492.34 263 1074 492.83 465 521 213797 213797 0.00%
crit 19.31% 103.90 64 153 984.95 525 2147 986.00 842 1122 102367 102367 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1348 (1828) 13.6% (18.4%) 21.7 13.37sec 25155 12825 Direct 43.2 (86.0) 0 9319 9319 100.0% (59.7%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.68 43.16 0.00 0.00 1.9615 0.0000 402271.50 402271.50 0.00% 12824.81 12824.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 43.16 30 58 9318.72 5875 13464 9317.68 9024 9534 402272 402272 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:21.79
  • if_expr:cast_time<havoc_remains
    Internal Combustion 480 4.8% 42.8 13.44sec 3347 0 Direct 42.8 2813 5626 3347 19.0%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.79 42.79 0.00 0.00 0.0000 0.0000 143218.87 143218.87 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.03% 34.67 22 48 2813.19 1 4496 2817.02 2516 3060 97600 97600 0.00%
crit 18.97% 8.12 2 16 5625.79 321 8986 5630.47 3897 7397 45619 45619 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 831 8.4% 36.8 7.96sec 6754 5400 Direct 56.4 3699 7375 4401 19.1%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.77 56.41 0.00 0.00 1.2506 0.0000 248325.86 248325.86 0.00% 5400.38 5400.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.87% 45.62 32 61 3698.99 2047 5546 3698.11 3449 3915 168674 168674 0.00%
crit 19.13% 10.79 0 23 7375.36 4100 11090 7380.18 0 9450 79652 79652 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:17.15
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.60
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1648 16.6% 26.5 10.93sec 18591 14741 Direct 33.7 1568 3130 1875 19.6%
Periodic 346.3 1041 2081 1240 19.1% 95.8%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.50 33.72 346.25 346.25 1.2612 2.4824 492714.36 492714.36 0.00% 551.77 14740.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.36% 27.10 17 40 1568.46 819 2218 1568.93 1447 1689 42506 42506 0.00%
crit 19.64% 6.62 1 16 3130.13 1640 4436 3131.13 2133 3913 20738 20738 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.88% 280.04 211 354 1041.37 0 1387 1041.50 1022 1062 291637 291637 0.00%
crit 19.12% 66.21 42 99 2081.49 3 2773 2082.17 1937 2191 137833 137833 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [G]:17.82
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.81
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 628 6.3% 44.6 6.15sec 4214 2877 Direct 55.0 (55.0) 2854 5736 3412 19.4% (19.4%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.57 55.05 0.00 0.00 1.4645 0.0000 187823.67 187823.67 0.00% 2877.47 2877.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 44.37 27 64 2853.97 1329 3768 2855.28 2641 3062 126617 126617 0.00%
crit 19.39% 10.68 2 23 5736.50 2649 7536 5732.12 4150 6871 61206 61206 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:33.98
    havoc
    [R]:10.82
  • if_expr:cast_time<havoc_remains
Rain of Fire 940 9.5% 17.4 16.42sec 16141 12950 Periodic 413.0 570 1140 679 19.2% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.38 0.00 0.00 413.04 1.2465 0.0000 280590.05 280590.05 0.00% 12949.51 12949.51
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.79% 333.70 208 457 569.94 507 659 570.11 561 582 190179 190179 0.00%
crit 19.21% 79.34 47 123 1139.58 1013 1318 1139.89 1107 1172 90411 90411 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.33
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [J]:12.04
Soul Fire 532 5.4% 5.5 49.33sec 28702 8254 Direct 7.8 16987 33435 20303 20.2%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.54 7.83 0.00 0.00 3.4775 0.0000 158988.53 158988.53 0.00% 8254.00 8254.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.83% 6.25 2 11 16986.87 8619 23265 17038.63 13386 20822 106124 106124 0.00%
crit 20.17% 1.58 0 5 33435.43 17198 46586 27829.22 0 46389 52864 52864 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.29
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.36
  • if_expr:cast_time<havoc_remains
Soul Rot 353 3.6% 5.3 62.37sec 20024 16026 Periodic 96.5 914 1831 1093 19.5% 13.9%

Stats Details: Soul Rot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.27 0.00 96.51 96.51 1.2495 1.2895 105500.72 105500.72 0.00% 805.19 16026.24
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.45% 77.64 51 98 914.00 424 1535 913.77 859 1011 70945 70945 0.00%
crit 19.55% 18.87 6 34 1831.05 849 3069 1830.91 1411 2243 34556 34556 0.00%

Action Details: Soul Rot

  • id:325640
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • harmful:true

Resources

  • resource:mana
  • base_cost:250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:325640
  • name:Soul Rot
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.

Action Priority List

    aoe
    [E]:5.29
Summon Infernal 84 0.8% 2.0 180.66sec 12474 10786 Direct 6.0 3517 7021 4158 18.3%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24948.16 24948.16 0.00% 10786.06 10786.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.71% 4.90 2 6 3516.71 3348 3683 3516.37 3348 3683 17238 17238 0.00%
crit 18.29% 1.10 0 4 7020.62 6696 7366 4931.13 0 7366 7710 7710 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3511 / 714
Immolation 3245 6.6% 39.0 5.50sec 4993 0 Direct 117.0 1395 2790 1664 19.3%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194732.00 194732.00 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 94.41 78 106 1395.06 1395 1395 1395.06 1395 1395 131711 131711 0.00%
crit 19.31% 22.59 11 39 2790.11 2790 2790 2790.11 2790 2790 63021 63021 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.5% 41.0 5.25sec 388 270 Direct 41.0 326 651 388 19.2%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15911.95 22728.63 29.99% 270.13 270.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 33.12 24 40 325.55 326 326 325.55 326 326 10783 15403 29.99%
crit 19.21% 7.88 1 17 651.10 651 651 651.10 651 651 5129 7326 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.2% 93.0 3.22sec 1652 1135 Direct 92.3 1395 2790 1664 19.3%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.02 92.30 0.00 0.00 1.4558 0.0000 153661.54 153661.54 0.00% 1134.70 1134.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 74.45 53 96 1395.06 1395 1395 1395.06 1395 1395 103868 103868 0.00%
crit 19.34% 17.85 6 33 2790.11 2790 2790 2790.11 2790 2790 49793 49793 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.47
Simple Action Stats Execute Interval
NightFae_Koraylon
Havoc 9.6 32.06sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.64 0.00 0.00 0.00 1.2442 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [I]:9.63
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.8 0.0 8.0sec 8.0sec 4.1sec 50.66% 0.00% 0.0 (0.0) 1.5

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 24.5s
  • trigger_min/max:2.1s / 24.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:50.66%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.56% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.56%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Soul Rot 5.3 0.0 62.4sec 62.4sec 7.9sec 13.90% 0.00% 0.0 (0.0) 5.1

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_soul_rot
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:61.3s / 68.4s
  • trigger_min/max:61.3s / 68.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • soul_rot_1:13.90%

Spelldata

  • id:325640
  • name:Soul Rot
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 185.2s
  • trigger_min/max:180.0s / 185.2s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 185.2s
  • trigger_min/max:180.0s / 185.2s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.26% 10.07% 17.45% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Koraylon
soul_fire Soul Shard 6.55 7.18 7.57% 1.10 0.71 9.01%
immolate Soul Shard 346.26 33.50 35.34% 0.10 1.13 3.25%
incinerate Soul Shard 44.58 11.06 11.67% 0.25 0.01 0.06%
conflagrate Soul Shard 36.76 28.18 29.74% 0.77 0.00 0.00%
mana_regen Mana 657.19 115437.13 100.00% 175.65 33810.67 22.65%
immolate_crits Soul Shard 33.43 3.23 3.41% 0.10 0.11 3.36%
incinerate_crits Soul Shard 10.66 1.07 1.12% 0.10 0.00 0.03%
infernal Soul Shard 120.00 10.57 11.15% 0.09 1.43 11.91%
pet - imp
energy_regen Energy 360.01 3550.34 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 385.92 388.49 33822.4 49230.8 47877.0 50000.0
Soul Shard 4.0 0.32 0.32 3.4 2.3 0.0 5.0
Usage Type Count Total Avg RPE APR
NightFae_Koraylon
cataclysm Mana 9.7 4849.5 500.0 500.4 49.2
channel_demonfire Mana 12.0 9016.4 750.0 750.4 35.1
chaos_bolt Soul Shard 21.7 43.4 2.0 2.0 12580.4
conflagrate Mana 36.8 18379.1 500.0 499.9 13.5
havoc Mana 9.6 9633.4 1000.0 999.8 0.0
immolate Mana 26.5 19884.9 750.0 750.3 24.8
incinerate Mana 44.6 44580.3 1000.0 1000.2 4.2
rain_of_fire Soul Shard 17.4 52.1 3.0 3.0 5383.7
soul_fire Mana 6.5 6549.1 1000.0 1182.3 24.3
soul_rot Mana 5.3 1315.5 250.0 249.7 80.2
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.5
pet - imp
firebolt Energy 93.0 3720.9 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
NightFae_Koraylon Fight Length
Count 625
Mean 299.05
Minimum 240.24
Maximum 359.94
Spread ( max - min ) 119.70
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
NightFae_Koraylon Damage Per Second
Count 625
Mean 9929.31
Minimum 9418.23
Maximum 10718.40
Spread ( max - min ) 1300.17
Range [ ( max - min ) / 2 * 100% ] 6.55%
Standard Deviation 222.9172
5th Percentile 9596.51
95th Percentile 10313.77
( 95th Percentile - 5th Percentile ) 717.26
Mean Distribution
Standard Deviation 8.9167
95.00% Confidence Interval ( 9911.84 - 9946.79 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1937
0.1 Scale Factor Error with Delta=300 425
0.05 Scale Factor Error with Delta=300 1697
0.01 Scale Factor Error with Delta=300 42421
Priority Target DPS
NightFae_Koraylon Priority Target Damage Per Second
Count 625
Mean 5327.86
Minimum 5020.25
Maximum 5822.11
Spread ( max - min ) 801.86
Range [ ( max - min ) / 2 * 100% ] 7.53%
Standard Deviation 125.4541
5th Percentile 5133.51
95th Percentile 5543.78
( 95th Percentile - 5th Percentile ) 410.27
Mean Distribution
Standard Deviation 5.0182
95.00% Confidence Interval ( 5318.03 - 5337.70 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2130
0.1 Scale Factor Error with Delta=300 135
0.05 Scale Factor Error with Delta=300 538
0.01 Scale Factor Error with Delta=300 13436
DPS(e)
NightFae_Koraylon Damage Per Second (Effective)
Count 625
Mean 9929.31
Minimum 9418.23
Maximum 10718.40
Spread ( max - min ) 1300.17
Range [ ( max - min ) / 2 * 100% ] 6.55%
Damage
NightFae_Koraylon Damage
Count 625
Mean 2599217.22
Minimum 2107798.80
Maximum 3134751.42
Spread ( max - min ) 1026952.62
Range [ ( max - min ) / 2 * 100% ] 19.76%
DTPS
NightFae_Koraylon Damage Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Koraylon Healing Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Koraylon Healing Per Second (Effective)
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Koraylon Heal
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Koraylon Healing Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Koraylon Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_KoraylonTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Koraylon Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.29 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.76 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.33 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
E 5.29 soul_rot
F 12.02 channel_demonfire,if=dot.immolate.remains>cast_time
G 17.82 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
H 0.00 call_action_list,name=cds
I 9.63 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
J 12.04 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 17.15 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 33.98 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.60 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.36 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.81 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 21.79 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 10.82 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEFMIQNQNPQNQNDFGGDGLKLLDKALLJFINQRRNOPGJLKFJLKAELLINQQPRNFGLJKLLLLA9IQNQNQPNFGJLKLLLEAJIRNQRNPRF9GJKLJKLLAIQRNQRNFGGJGLKLMLEDKA9FIQNQNPQDGLKLGFLAJKLIQRNPQRN9FEGJKLAJKIRRRQNQPFGGKLLLKJALIONQQFKLGGGJEKLLLKAI

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.741 aoe E soul_rot Fluffy_Pillow 49370.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:02.745 aoe F channel_demonfire Fluffy_Pillow 49622.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, soul_rot
0:05.043 cds M summon_infernal Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, soul_rot
0:06.049 aoe I havoc enemy2 49503.0/50000: 99% mana
4.8/5: 96% soul_shard
bloodlust, soul_rot
0:07.056 havoc Q chaos_bolt Fluffy_Pillow 49006.5/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust, soul_rot
0:09.062 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, soul_rot
0:10.067 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, soul_rot
0:11.473 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:12.479 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:13.484 havoc Q chaos_bolt Fluffy_Pillow 49251.5/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:14.891 havoc N conflagrate Fluffy_Pillow 49955.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust
0:15.897 havoc Q chaos_bolt Fluffy_Pillow 49958.0/50000: 100% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:17.304 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:18.310 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:19.316 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
bloodlust, backdraft
0:21.783 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust, backdraft
0:22.790 aoe G immolate enemy2 49252.5/50000: 99% mana
2.9/5: 58% soul_shard
bloodlust, backdraft
0:23.798 aoe D rain_of_fire Fluffy_Pillow 49006.5/50000: 98% mana
3.2/5: 64% soul_shard
bloodlust, backdraft
0:24.805 aoe G immolate enemy3 49510.0/50000: 99% mana
0.4/5: 8% soul_shard
bloodlust, backdraft
0:25.812 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.8/5: 16% soul_shard
bloodlust, backdraft
0:26.753 aoe K conflagrate Fluffy_Pillow 48723.0/50000: 97% mana
1.2/5: 24% soul_shard
bloodlust
0:27.759 aoe L incinerate Fluffy_Pillow 48726.0/50000: 97% mana
2.0/5: 40% soul_shard
bloodlust, backdraft
0:28.699 aoe L incinerate Fluffy_Pillow 48196.0/50000: 96% mana
2.6/5: 52% soul_shard
bloodlust
0:30.037 aoe D rain_of_fire Fluffy_Pillow 47865.0/50000: 96% mana
3.5/5: 70% soul_shard
bloodlust
0:31.042 aoe K conflagrate Fluffy_Pillow 48367.5/50000: 97% mana
0.7/5: 14% soul_shard
bloodlust
0:32.048 default A cataclysm Fluffy_Pillow 48370.5/50000: 97% mana
1.9/5: 38% soul_shard
bloodlust, backdraft
0:33.388 aoe L incinerate Fluffy_Pillow 48540.5/50000: 97% mana
2.1/5: 42% soul_shard
bloodlust, backdraft
0:34.327 aoe L incinerate Fluffy_Pillow 48010.0/50000: 96% mana
2.8/5: 56% soul_shard
bloodlust
0:35.668 aoe J rain_of_fire Fluffy_Pillow 47680.5/50000: 95% mana
3.2/5: 64% soul_shard
bloodlust
0:36.674 aoe F channel_demonfire Fluffy_Pillow 48183.5/50000: 96% mana
0.6/5: 12% soul_shard
bloodlust
0:38.864 aoe I havoc enemy2 48528.5/50000: 97% mana
0.9/5: 18% soul_shard
bloodlust
0:39.871 havoc N conflagrate Fluffy_Pillow 48032.0/50000: 96% mana
1.2/5: 24% soul_shard
bloodlust
0:40.878 havoc Q chaos_bolt Fluffy_Pillow 48035.5/50000: 96% mana
2.2/5: 44% soul_shard
bloodlust, backdraft
0:42.284 havoc R incinerate Fluffy_Pillow 48738.5/50000: 97% mana
0.5/5: 10% soul_shard
0:44.023 havoc R incinerate Fluffy_Pillow 48608.0/50000: 97% mana
0.9/5: 18% soul_shard
0:45.764 havoc N conflagrate Fluffy_Pillow 48478.5/50000: 97% mana
1.7/5: 34% soul_shard
0:47.070 havoc O soul_fire Fluffy_Pillow 48631.5/50000: 97% mana
3.0/5: 60% soul_shard
backdraft
0:50.546 havoc P immolate Fluffy_Pillow 49001.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:51.854 aoe G immolate enemy3 48905.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:53.159 aoe J rain_of_fire Fluffy_Pillow 48808.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:54.468 aoe L incinerate Fluffy_Pillow 49462.5/50000: 99% mana
2.1/5: 42% soul_shard
backdraft
0:55.688 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.5/5: 50% soul_shard
0:56.995 aoe F channel_demonfire Fluffy_Pillow 49156.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
0:59.913 aoe J rain_of_fire Fluffy_Pillow 49865.0/50000: 100% mana
3.4/5: 68% soul_shard
backdraft
1:01.218 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
1:02.437 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
1:03.745 default A cataclysm Fluffy_Pillow 49156.0/50000: 98% mana
1.6/5: 32% soul_shard
backdraft
1:05.486 aoe E soul_rot Fluffy_Pillow 49502.5/50000: 99% mana
1.9/5: 38% soul_shard
backdraft
1:06.794 aoe L incinerate Fluffy_Pillow 49753.0/50000: 100% mana
1.9/5: 38% soul_shard
backdraft, soul_rot
1:08.015 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
2.4/5: 48% soul_shard
soul_rot
1:09.756 aoe I havoc enemy2 48873.5/50000: 98% mana
2.6/5: 52% soul_shard
soul_rot
1:11.063 havoc N conflagrate Fluffy_Pillow 48527.0/50000: 97% mana
2.9/5: 58% soul_shard
soul_rot
1:12.369 havoc Q chaos_bolt Fluffy_Pillow 48680.0/50000: 97% mana
3.9/5: 78% soul_shard
backdraft, soul_rot
1:14.196 havoc Q chaos_bolt Fluffy_Pillow 49593.5/50000: 99% mana
2.2/5: 44% soul_shard
soul_rot
1:16.804 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
1:18.110 havoc R incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.6/5: 12% soul_shard
1:19.851 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
1:21.159 aoe F channel_demonfire Fluffy_Pillow 49156.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
1:24.021 aoe G immolate enemy3 49837.5/50000: 100% mana
2.9/5: 58% soul_shard
backdraft
1:25.327 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
2.9/5: 58% soul_shard
backdraft
1:26.548 aoe J rain_of_fire Fluffy_Pillow 48862.5/50000: 98% mana
3.6/5: 72% soul_shard
1:27.853 aoe K conflagrate Fluffy_Pillow 49515.0/50000: 99% mana
0.6/5: 12% soul_shard
1:29.160 aoe L incinerate Fluffy_Pillow 49668.5/50000: 99% mana
1.4/5: 28% soul_shard
backdraft
1:30.378 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
1.6/5: 32% soul_shard
1:32.118 aoe L incinerate Fluffy_Pillow 48871.5/50000: 98% mana
2.1/5: 42% soul_shard
1:33.858 aoe L incinerate Fluffy_Pillow 48741.5/50000: 97% mana
2.4/5: 48% soul_shard
1:35.597 default A cataclysm Fluffy_Pillow 48611.0/50000: 97% mana
2.9/5: 58% soul_shard
1:37.337 default 9 soul_fire Fluffy_Pillow 48981.0/50000: 98% mana
3.3/5: 66% soul_shard
1:40.816 aoe I havoc enemy2 49003.0/50000: 98% mana
4.6/5: 92% soul_shard
1:42.122 havoc Q chaos_bolt Fluffy_Pillow 48656.0/50000: 97% mana
4.7/5: 94% soul_shard
1:44.730 havoc N conflagrate Fluffy_Pillow 49960.0/50000: 100% mana
3.0/5: 60% soul_shard
1:46.036 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
backdraft
1:47.865 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
1:49.171 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.5/5: 70% soul_shard
backdraft
1:50.998 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
1:52.305 havoc N conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
1.9/5: 38% soul_shard
1:53.609 aoe F channel_demonfire Fluffy_Pillow 49404.5/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
1:56.522 aoe G immolate enemy3 50000.0/50000: 100% mana
3.5/5: 70% soul_shard
backdraft
1:57.829 aoe J rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
1:59.134 aoe L incinerate Fluffy_Pillow 49905.0/50000: 100% mana
0.8/5: 16% soul_shard
backdraft
2:00.354 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
2:01.872 aoe L incinerate Fluffy_Pillow 49261.5/50000: 99% mana
1.8/5: 36% soul_shard
backdraft
2:03.091 aoe L incinerate Fluffy_Pillow 48871.0/50000: 98% mana
2.1/5: 42% soul_shard
2:04.830 aoe L incinerate Fluffy_Pillow 48740.5/50000: 97% mana
2.5/5: 50% soul_shard
2:06.570 aoe E soul_rot Fluffy_Pillow 48610.5/50000: 97% mana
3.0/5: 60% soul_shard
2:08.096 default A cataclysm Fluffy_Pillow 49123.5/50000: 98% mana
3.1/5: 62% soul_shard
soul_rot
2:09.836 aoe J rain_of_fire Fluffy_Pillow 49493.5/50000: 99% mana
3.5/5: 70% soul_shard
soul_rot
2:11.144 aoe I havoc enemy2 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
soul_rot
2:12.450 havoc R incinerate Fluffy_Pillow 49653.0/50000: 99% mana
0.9/5: 18% soul_shard
soul_rot
2:14.189 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.4/5: 28% soul_shard
soul_rot
2:15.496 havoc Q chaos_bolt Fluffy_Pillow 49155.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft, soul_rot
2:17.324 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
2:19.064 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
2:20.370 havoc P immolate Fluffy_Pillow 49155.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:21.678 havoc R incinerate Fluffy_Pillow 49059.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
2:22.898 aoe F channel_demonfire Fluffy_Pillow 48669.0/50000: 97% mana
3.3/5: 66% soul_shard
2:25.735 default 9 soul_fire Fluffy_Pillow 49337.5/50000: 99% mana
3.6/5: 72% soul_shard
2:29.288 aoe G immolate enemy3 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
2:30.596 aoe J rain_of_fire Fluffy_Pillow 48906.5/50000: 98% mana
5.0/5: 100% soul_shard
2:31.903 aoe K conflagrate Fluffy_Pillow 49560.0/50000: 99% mana
2.3/5: 46% soul_shard
2:33.210 aoe L incinerate Fluffy_Pillow 49713.5/50000: 99% mana
2.8/5: 56% soul_shard
backdraft
2:34.430 aoe J rain_of_fire Fluffy_Pillow 49002.5/50000: 98% mana
3.4/5: 68% soul_shard
2:35.738 aoe K conflagrate Fluffy_Pillow 49656.5/50000: 99% mana
0.4/5: 8% soul_shard
2:37.046 aoe L incinerate Fluffy_Pillow 49810.5/50000: 100% mana
1.2/5: 24% soul_shard
backdraft
2:38.265 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
2:40.005 default A cataclysm Fluffy_Pillow 48872.0/50000: 98% mana
2.1/5: 42% soul_shard
2:41.748 aoe I havoc enemy2 49243.5/50000: 98% mana
2.4/5: 48% soul_shard
2:43.054 havoc Q chaos_bolt Fluffy_Pillow 48896.5/50000: 98% mana
2.4/5: 48% soul_shard
2:45.664 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
2:47.403 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.4/5: 28% soul_shard
2:48.709 havoc Q chaos_bolt Fluffy_Pillow 49154.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:50.536 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
2:52.278 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.5/5: 30% soul_shard
2:53.769 aoe F channel_demonfire Fluffy_Pillow 49248.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
2:56.617 aoe G immolate Fluffy_Pillow 49922.5/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
2:57.923 aoe G immolate enemy2 49252.0/50000: 99% mana
3.0/5: 60% soul_shard
backdraft
2:59.228 aoe J rain_of_fire Fluffy_Pillow 49154.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
3:00.532 aoe G immolate enemy3 49806.5/50000: 100% mana
0.2/5: 4% soul_shard
backdraft
3:01.837 aoe L incinerate Fluffy_Pillow 49251.5/50000: 99% mana
0.3/5: 6% soul_shard
backdraft
3:03.056 aoe K conflagrate Fluffy_Pillow 48861.0/50000: 98% mana
0.6/5: 12% soul_shard
3:04.362 aoe L incinerate Fluffy_Pillow 49014.0/50000: 98% mana
1.2/5: 24% soul_shard
backdraft
3:05.582 cds M summon_infernal Fluffy_Pillow 48624.0/50000: 97% mana
1.6/5: 32% soul_shard
3:06.890 aoe L incinerate Fluffy_Pillow 48278.0/50000: 97% mana
1.9/5: 38% soul_shard
3:08.631 aoe E soul_rot Fluffy_Pillow 48148.5/50000: 96% mana
2.8/5: 56% soul_shard
3:09.937 aoe D rain_of_fire Fluffy_Pillow 48551.5/50000: 97% mana
3.2/5: 64% soul_shard
soul_rot
3:11.244 aoe K conflagrate Fluffy_Pillow 49205.0/50000: 98% mana
0.7/5: 14% soul_shard
soul_rot
3:12.551 default A cataclysm Fluffy_Pillow 49358.5/50000: 99% mana
1.5/5: 30% soul_shard
backdraft, soul_rot
3:14.291 default 9 soul_fire Fluffy_Pillow 49502.0/50000: 99% mana
2.1/5: 42% soul_shard
backdraft, soul_rot
3:17.770 aoe F channel_demonfire Fluffy_Pillow 49003.0/50000: 98% mana
4.2/5: 84% soul_shard
backdraft, soul_rot
3:20.664 aoe I havoc enemy2 49700.0/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
3:21.970 havoc Q chaos_bolt Fluffy_Pillow 49353.0/50000: 99% mana
5.0/5: 100% soul_shard
3:24.579 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:25.887 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft
3:27.715 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:29.023 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft
3:30.328 havoc Q chaos_bolt Fluffy_Pillow 49251.5/50000: 99% mana
4.8/5: 96% soul_shard
backdraft
3:32.156 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:33.461 aoe G immolate enemy3 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
3:34.769 aoe L incinerate Fluffy_Pillow 49253.0/50000: 99% mana
0.8/5: 16% soul_shard
3:36.509 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
3:37.817 aoe L incinerate Fluffy_Pillow 49156.0/50000: 98% mana
2.0/5: 40% soul_shard
backdraft
3:39.036 aoe G immolate enemy2 48765.5/50000: 98% mana
2.4/5: 48% soul_shard
3:40.343 aoe F channel_demonfire Fluffy_Pillow 48669.0/50000: 97% mana
2.5/5: 50% soul_shard
3:43.212 aoe L incinerate Fluffy_Pillow 49353.5/50000: 99% mana
2.9/5: 58% soul_shard
3:44.952 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
3.4/5: 68% soul_shard
3:46.692 aoe J rain_of_fire Fluffy_Pillow 49372.0/50000: 99% mana
3.7/5: 74% soul_shard
3:47.998 aoe K conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
3:49.304 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
backdraft
3:50.525 aoe I havoc enemy2 49003.0/50000: 98% mana
1.9/5: 38% soul_shard
3:51.970 havoc Q chaos_bolt Fluffy_Pillow 48725.5/50000: 97% mana
2.1/5: 42% soul_shard
3:54.578 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
3:56.319 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.0/5: 20% soul_shard
3:57.627 havoc P immolate Fluffy_Pillow 49156.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
3:58.935 havoc Q chaos_bolt Fluffy_Pillow 49060.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
4:00.763 havoc R incinerate Fluffy_Pillow 49974.5/50000: 100% mana
0.7/5: 14% soul_shard
4:02.504 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
4:03.811 default 9 soul_fire Fluffy_Pillow 49156.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
4:07.290 aoe F channel_demonfire Fluffy_Pillow 49003.0/50000: 98% mana
3.9/5: 78% soul_shard
backdraft
4:10.205 aoe E soul_rot Fluffy_Pillow 49710.5/50000: 99% mana
4.4/5: 88% soul_shard
backdraft
4:11.511 aoe G immolate enemy3 49752.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft, soul_rot
4:12.818 aoe J rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
4.6/5: 92% soul_shard
soul_rot
4:14.124 aoe K conflagrate Fluffy_Pillow 49905.5/50000: 100% mana
1.6/5: 32% soul_shard
soul_rot
4:15.430 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
backdraft, soul_rot
4:16.649 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
2.6/5: 52% soul_shard
soul_rot
4:18.429 aoe J rain_of_fire Fluffy_Pillow 49392.0/50000: 99% mana
3.0/5: 60% soul_shard
soul_rot
4:19.734 aoe K conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.0/5: 0% soul_shard
4:21.041 aoe I havoc enemy2 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
backdraft
4:22.347 havoc R incinerate Fluffy_Pillow 49653.0/50000: 99% mana
0.8/5: 16% soul_shard
backdraft
4:23.567 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
4:25.308 havoc R incinerate Fluffy_Pillow 48873.0/50000: 98% mana
1.9/5: 38% soul_shard
4:27.049 havoc Q chaos_bolt Fluffy_Pillow 48743.5/50000: 97% mana
2.6/5: 52% soul_shard
4:29.657 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
4:30.963 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.0/5: 40% soul_shard
backdraft
4:32.792 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
4:34.098 aoe F channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
0.5/5: 10% soul_shard
4:37.044 aoe G immolate enemy3 49975.0/50000: 100% mana
0.7/5: 14% soul_shard
4:38.352 aoe G immolate enemy2 49253.0/50000: 99% mana
0.7/5: 14% soul_shard
4:39.661 aoe K conflagrate Fluffy_Pillow 49157.5/50000: 98% mana
0.9/5: 18% soul_shard
4:40.968 aoe L incinerate Fluffy_Pillow 49311.0/50000: 99% mana
1.4/5: 28% soul_shard
backdraft
4:42.186 aoe L incinerate Fluffy_Pillow 48920.0/50000: 98% mana
1.8/5: 36% soul_shard
4:43.924 aoe L incinerate Fluffy_Pillow 48789.0/50000: 98% mana
2.1/5: 42% soul_shard
4:45.664 aoe K conflagrate Fluffy_Pillow 48659.0/50000: 97% mana
2.7/5: 54% soul_shard
4:46.971 aoe J rain_of_fire Fluffy_Pillow 48812.5/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
4:48.278 default A cataclysm Fluffy_Pillow 49466.0/50000: 99% mana
0.5/5: 10% soul_shard
backdraft
4:50.164 aoe L incinerate Fluffy_Pillow 49502.0/50000: 99% mana
0.9/5: 18% soul_shard
backdraft
4:51.382 aoe I havoc enemy2 49001.5/50000: 98% mana
1.1/5: 22% soul_shard
4:52.688 havoc O soul_fire Fluffy_Pillow 48654.5/50000: 97% mana
1.3/5: 26% soul_shard
4:56.166 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
3.8/5: 76% soul_shard
4:57.474 havoc Q chaos_bolt Fluffy_Pillow 49156.5/50000: 98% mana
4.9/5: 98% soul_shard
backdraft
4:59.301 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
5:01.910 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
5:04.763 aoe K conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
5:06.068 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
backdraft
5:07.287 aoe G immolate enemy2 49002.0/50000: 98% mana
2.7/5: 54% soul_shard
5:08.593 aoe G immolate Fluffy_Pillow 48905.0/50000: 98% mana
3.0/5: 60% soul_shard
5:09.899 aoe G immolate enemy3 48808.0/50000: 98% mana
3.0/5: 60% soul_shard
5:11.206 aoe J rain_of_fire Fluffy_Pillow 48711.5/50000: 97% mana
3.3/5: 66% soul_shard
5:12.510 aoe E soul_rot Fluffy_Pillow 49363.5/50000: 99% mana
0.3/5: 6% soul_shard
5:13.815 aoe K conflagrate Fluffy_Pillow 49751.5/50000: 100% mana
0.6/5: 12% soul_shard
soul_rot
5:15.121 aoe L incinerate Fluffy_Pillow 49904.5/50000: 100% mana
1.1/5: 22% soul_shard
backdraft, soul_rot
5:16.340 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.6/5: 32% soul_shard
soul_rot
5:18.080 aoe L incinerate Fluffy_Pillow 48872.0/50000: 98% mana
1.9/5: 38% soul_shard
soul_rot
5:19.820 aoe K conflagrate Fluffy_Pillow 48742.0/50000: 97% mana
2.3/5: 46% soul_shard
soul_rot
5:21.126 default A cataclysm Fluffy_Pillow 48895.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft, soul_rot
5:22.865 aoe I havoc enemy2 49264.5/50000: 99% mana
3.2/5: 64% soul_shard
backdraft

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="NightFae_Koraylon"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=night_fae
soulbind=325066/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

NightFae_Niya : 9982 dps, 5355 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9982.0 9982.0 16.8 / 0.168% 777.3 / 7.8% 22.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
388.6 386.0 Mana 0.00% 38.5 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Niya 9982
Cataclysm 798 8.0% 9.7 32.37sec 24662 14515 Direct 29.0 6886 13801 8215 19.3%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.68 29.03 0.00 0.00 1.6992 0.0000 238647.52 238647.52 0.00% 14514.51 14514.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 23.43 14 32 6886.03 6142 8191 6884.33 6631 7153 161307 161307 0.00%
crit 19.30% 5.60 0 12 13801.36 12283 16210 13788.46 0 15455 77340 77340 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.73
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1064) 0.0% (10.7%) 12.0 25.83sec 26495 9850

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.00 0.00 178.96 0.00 2.6898 0.1633 0.00 0.00 0.00% 9850.00 9850.00

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [F]:12.00
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1064 10.7% 0.0 0.00sec 0 0 Direct 536.9 496 992 592 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 536.89 0.00 0.00 0.0000 0.0000 317810.16 317810.16 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 433.06 316 566 496.17 263 1093 496.40 462 524 214820 214820 0.00%
crit 19.34% 103.83 64 145 991.75 525 2179 992.50 763 1156 102990 102990 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1361 (1831) 13.6% (18.3%) 21.6 13.27sec 25261 12877 Direct 43.0 (85.7) 0 9438 9438 100.0% (60.0%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.64 43.04 0.00 0.00 1.9617 0.0000 406259.96 406259.96 0.00% 12876.90 12876.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 43.04 32 56 9438.31 5872 13796 9438.19 9112 9732 406260 406260 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:21.75
  • if_expr:cast_time<havoc_remains
    Internal Combustion 470 4.7% 42.7 13.28sec 3286 0 Direct 42.7 2750 5475 3287 19.7%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.70 42.70 0.00 0.00 0.0000 0.0000 140300.21 140300.21 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.34% 34.30 22 49 2749.71 1 4088 2752.16 2535 2942 94332 94332 0.00%
crit 19.66% 8.40 1 17 5475.36 361 8134 5474.40 3309 6705 45968 45968 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 844 8.5% 36.8 7.96sec 6848 5476 Direct 56.4 3738 7514 4465 19.3%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.81 56.44 0.00 0.00 1.2505 0.0000 252063.22 252063.22 0.00% 5476.42 5476.42
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 45.57 28 60 3738.35 2049 5666 3740.04 3490 4081 170391 170391 0.00%
crit 19.27% 10.88 2 23 7513.92 4097 11112 7496.29 5399 9393 81672 81672 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:17.17
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.63
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1677 16.8% 26.7 10.70sec 18809 14911 Direct 33.9 1595 3191 1906 19.6%
Periodic 346.3 1056 2112 1261 19.4% 95.9%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.65 33.88 346.35 346.35 1.2615 2.4835 501288.90 501288.90 0.00% 560.86 14910.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.45% 27.26 16 40 1594.73 820 2254 1595.55 1471 1724 43476 43476 0.00%
crit 19.55% 6.62 0 14 3190.70 1638 4489 3171.80 0 4160 21118 21118 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.62% 279.22 210 344 1056.22 1 1419 1056.28 1034 1078 294931 294931 0.00%
crit 19.38% 67.13 43 98 2111.67 1 2843 2111.65 1989 2220 141764 141764 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [G]:17.96
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.78
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 637 6.4% 44.5 6.23sec 4288 2930 Direct 54.9 (54.9) 2907 5792 3473 19.7% (19.7%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.50 54.93 0.00 0.00 1.4634 0.0000 190821.47 190821.47 0.00% 2930.35 2930.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.35% 44.14 28 68 2906.83 1329 3830 2908.73 2687 3117 128308 128308 0.00%
crit 19.65% 10.80 3 22 5791.78 2781 7683 5801.57 3776 6907 62513 62513 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:33.92
    havoc
    [R]:10.86
  • if_expr:cast_time<havoc_remains
Rain of Fire 951 9.5% 17.4 16.67sec 16292 13063 Periodic 413.2 576 1153 687 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.43 0.00 0.00 413.16 1.2472 0.0000 283941.42 283941.42 0.00% 13063.19 13063.19
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.73% 333.56 214 466 576.19 507 674 576.18 566 591 192184 192184 0.00%
crit 19.27% 79.61 49 118 1152.53 1013 1349 1152.57 1122 1188 91758 91758 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.33
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [J]:12.10
Soul Fire 531 5.3% 5.5 49.31sec 28629 8233 Direct 7.8 16814 33893 20278 20.4%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.54 7.82 0.00 0.00 3.4775 0.0000 158628.21 158628.21 0.00% 8232.73 8232.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.64% 6.23 3 10 16814.26 8648 23517 16855.94 13523 20672 104707 104707 0.00%
crit 20.36% 1.59 0 5 33892.52 17310 46635 28249.24 0 46476 53922 53922 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.28
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.35
  • if_expr:cast_time<havoc_remains
Soul Rot 340 3.4% 5.3 62.37sec 19259 15412 Periodic 96.6 884 1757 1052 19.3% 13.9%

Stats Details: Soul Rot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.28 0.00 96.64 96.64 1.2497 1.2890 101717.22 101717.22 0.00% 775.42 15411.70
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.71% 78.00 52 98 883.89 424 1395 883.96 832 941 68936 68936 0.00%
crit 19.29% 18.64 8 34 1757.42 849 2790 1760.18 1345 2267 32782 32782 0.00%

Action Details: Soul Rot

  • id:325640
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • harmful:true

Resources

  • resource:mana
  • base_cost:250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:325640
  • name:Soul Rot
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.

Action Priority List

    aoe
    [E]:5.29
Summon Infernal 81 0.8% 2.0 180.57sec 11922 10313 Direct 6.0 3348 6696 3976 18.7%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1564 0.0000 23844.08 23844.08 0.00% 10313.18 10313.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.31% 4.88 1 6 3348.13 3348 3348 3348.13 3348 3348 16334 16334 0.00%
crit 18.69% 1.12 0 5 6696.27 6696 6696 4799.89 0 6696 7511 7511 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3511 / 714
Immolation 3246 6.5% 39.0 5.49sec 4995 0 Direct 117.0 1395 2790 1665 19.3%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194790.03 194790.03 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 94.37 83 107 1395.06 1395 1395 1395.06 1395 1395 131653 131653 0.00%
crit 19.34% 22.63 10 34 2790.11 2790 2790 2790.11 2790 2790 63137 63137 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.5% 41.0 5.25sec 387 270 Direct 41.0 326 651 388 19.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15884.86 22689.94 29.99% 269.67 269.67
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.99% 33.21 26 40 325.55 326 326 325.55 326 326 10810 15442 29.99%
crit 19.01% 7.79 1 15 651.10 651 651 651.10 651 651 5074 7248 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.2% 93.0 3.22sec 1650 1133 Direct 92.3 1395 2790 1663 19.2%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.02 92.30 0.00 0.00 1.4558 0.0000 153487.44 153487.44 0.00% 1133.40 1133.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.80% 74.58 54 96 1395.06 1395 1395 1395.06 1395 1395 104042 104042 0.00%
crit 19.20% 17.72 6 32 2790.11 2790 2790 2790.11 2790 2790 49445 49445 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.47
Simple Action Stats Execute Interval
NightFae_Niya
Havoc 9.6 32.06sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.63 0.00 0.00 0.00 1.2442 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [I]:9.63
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.8 0.0 7.9sec 7.9sec 4.1sec 50.46% 0.00% 0.0 (0.0) 1.5

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 24.0s
  • trigger_min/max:2.1s / 24.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:50.46%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.56% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.56%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Redirected Anima 16.1 0.0 48.2sec 18.6sec 59.3sec 84.52% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_redirected_anima
  • max_stacks:50
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:25.00

Trigger Details

  • interval_min/max:0.0s / 332.8s
  • trigger_min/max:0.0s / 64.2s
  • trigger_pct:99.10%
  • duration_min/max:0.0s / 351.5s

Stack Uptimes

  • redirected_anima_1:20.55%
  • redirected_anima_2:9.76%
  • redirected_anima_3:3.14%
  • redirected_anima_4:0.76%
  • redirected_anima_5:0.11%
  • redirected_anima_6:0.02%
  • redirected_anima_7:0.00%
  • redirected_anima_8:17.07%
  • redirected_anima_9:19.94%
  • redirected_anima_10:9.64%
  • redirected_anima_11:2.75%
  • redirected_anima_12:0.69%
  • redirected_anima_13:0.24%
  • redirected_anima_14:0.07%
  • redirected_anima_15:0.03%

Spelldata

  • id:342814
  • name:Redirected Anima
  • tooltip:Max health increased by $w1%. Mastery increased by $w2.
  • description:{$@spelldesc322721=Healing or dealing damage has a chance to grant you a stack of Redirected Anima. Redirected Anima increases your maximum health by {$342814s1=1}% and your Mastery by {$342814s2=25} for {$342814d=30 seconds}, and stacks overlap. $?(s152280&a137005)[Defile]?(a137005&!s152280)[Death's Due]?a212611[The Hunt]?a137009[Convoke the Spirits]?a137014[Wild Spirits]?a137018[Shifting Power]?a137022[Faeline Stomp]?a137026[Blessing of Seasons]?a137030[Fae Guardians]?a137034[Sepsis]?a137038[Fae Transfusion]?a137042[Soul Rot]?a137047[Ancient Aftershock][Activating your Night Fae class ability] grants you ${{$s3=8}*$<mod>} stacks of Redirected Anima.}
  • max_stacks:50
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Soul Rot 5.3 0.0 62.4sec 62.4sec 7.9sec 13.92% 0.00% 0.0 (0.0) 5.1

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_soul_rot
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:61.3s / 68.3s
  • trigger_min/max:61.3s / 68.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • soul_rot_1:13.92%

Spelldata

  • id:325640
  • name:Soul Rot
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:NightFae_Niya_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 185.6s
  • trigger_min/max:180.0s / 185.6s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:NightFae_Niya_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 185.6s
  • trigger_min/max:180.0s / 185.6s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.25% 10.10% 17.37% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Niya
soul_fire Soul Shard 6.55 7.16 7.55% 1.09 0.73 9.24%
immolate Soul Shard 346.39 33.50 35.32% 0.10 1.14 3.28%
incinerate Soul Shard 44.52 11.05 11.65% 0.25 0.01 0.09%
conflagrate Soul Shard 36.80 28.21 29.74% 0.77 0.00 0.00%
mana_regen Mana 657.08 115452.41 100.00% 175.71 33789.43 22.64%
immolate_crits Soul Shard 33.85 3.27 3.45% 0.10 0.11 3.40%
incinerate_crits Soul Shard 10.78 1.08 1.14% 0.10 0.00 0.10%
infernal Soul Shard 120.00 10.58 11.15% 0.09 1.42 11.87%
pet - imp
energy_regen Energy 360.02 3550.34 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 386.01 388.62 33790.5 49219.3 47872.0 50000.0
Soul Shard 4.0 0.32 0.32 3.4 2.3 0.0 5.0
Usage Type Count Total Avg RPE APR
NightFae_Niya
cataclysm Mana 9.7 4842.4 500.0 500.4 49.3
channel_demonfire Mana 12.0 8997.7 750.0 750.1 35.3
chaos_bolt Soul Shard 21.6 43.3 2.0 2.0 12636.9
conflagrate Mana 36.8 18398.6 500.0 499.9 13.7
havoc Mana 9.6 9631.8 1000.0 1000.0 0.0
immolate Mana 26.6 19970.4 750.0 749.3 25.1
incinerate Mana 44.5 44524.2 1000.0 1000.6 4.3
rain_of_fire Soul Shard 17.4 52.3 3.0 3.0 5429.9
soul_fire Mana 6.6 6550.7 1000.0 1182.3 24.2
soul_rot Mana 5.3 1318.6 250.0 249.7 77.1
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 11.9
pet - imp
firebolt Energy 93.0 3720.9 40.0 40.0 41.2

Statistics & Data Analysis

Fight Length
NightFae_Niya Fight Length
Count 625
Mean 299.05
Minimum 240.24
Maximum 359.94
Spread ( max - min ) 119.70
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
NightFae_Niya Damage Per Second
Count 625
Mean 9982.01
Minimum 9424.74
Maximum 10546.64
Spread ( max - min ) 1121.90
Range [ ( max - min ) / 2 * 100% ] 5.62%
Standard Deviation 213.8096
5th Percentile 9660.80
95th Percentile 10346.11
( 95th Percentile - 5th Percentile ) 685.31
Mean Distribution
Standard Deviation 8.5524
95.00% Confidence Interval ( 9965.25 - 9998.78 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1763
0.1 Scale Factor Error with Delta=300 391
0.05 Scale Factor Error with Delta=300 1561
0.01 Scale Factor Error with Delta=300 39025
Priority Target DPS
NightFae_Niya Priority Target Damage Per Second
Count 625
Mean 5355.13
Minimum 4956.80
Maximum 5780.46
Spread ( max - min ) 823.67
Range [ ( max - min ) / 2 * 100% ] 7.69%
Standard Deviation 130.0598
5th Percentile 5162.03
95th Percentile 5582.31
( 95th Percentile - 5th Percentile ) 420.28
Mean Distribution
Standard Deviation 5.2024
95.00% Confidence Interval ( 5344.93 - 5365.32 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2266
0.1 Scale Factor Error with Delta=300 145
0.05 Scale Factor Error with Delta=300 578
0.01 Scale Factor Error with Delta=300 14441
DPS(e)
NightFae_Niya Damage Per Second (Effective)
Count 625
Mean 9982.01
Minimum 9424.74
Maximum 10546.64
Spread ( max - min ) 1121.90
Range [ ( max - min ) / 2 * 100% ] 5.62%
Damage
NightFae_Niya Damage
Count 625
Mean 2615322.38
Minimum 2092622.95
Maximum 3181076.36
Spread ( max - min ) 1088453.42
Range [ ( max - min ) / 2 * 100% ] 20.81%
DTPS
NightFae_Niya Damage Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Niya Healing Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Niya Healing Per Second (Effective)
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Niya Heal
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Niya Healing Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Niya Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_NiyaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Niya Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.28 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.73 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.33 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
E 5.29 soul_rot
F 12.00 channel_demonfire,if=dot.immolate.remains>cast_time
G 17.96 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
H 0.00 call_action_list,name=cds
I 9.63 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
J 12.10 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 17.17 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 33.92 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.63 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.35 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.78 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 21.75 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 10.86 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEFMIQNQNPQNQNDFGGDGLKLKDLALLINQQRNPQ9FGGJKLKLEAIQNQRRPNFJLGKLLJLLKA9FIQNQQPKGLLKJFELAKLLIQNPQRRN9FGGJKLAJKIRRQRNPFJLGKLMLDEKALIOQNQFDKGGDGLKLLLLAINQQNQPFKLL9GGEGJKAIQNQRRNPFGJLGKLLJKLLAIQONPQNFJLGKLEGGJLKA

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.742 aoe E soul_rot Fluffy_Pillow 49371.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:02.748 aoe F channel_demonfire Fluffy_Pillow 49624.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, soul_rot
0:04.920 cds M summon_infernal Fluffy_Pillow 49960.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, soul_rot, redirected_anima(8)
0:05.927 aoe I havoc enemy2 49463.5/50000: 99% mana
4.8/5: 96% soul_shard
bloodlust, soul_rot, redirected_anima(8)
0:06.934 havoc Q chaos_bolt Fluffy_Pillow 48967.0/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust, soul_rot, redirected_anima(8)
0:08.942 havoc N conflagrate Fluffy_Pillow 49971.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, soul_rot, redirected_anima(8)
0:09.947 havoc Q chaos_bolt Fluffy_Pillow 49973.5/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, soul_rot, redirected_anima(8)
0:11.354 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust, redirected_anima(8)
0:12.360 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, redirected_anima(8)
0:13.366 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft, redirected_anima(8)
0:14.773 havoc N conflagrate Fluffy_Pillow 49955.5/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust, redirected_anima(8)
0:15.778 havoc Q chaos_bolt Fluffy_Pillow 49958.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, redirected_anima(8)
0:17.185 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust, redirected_anima(8)
0:18.192 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft, redirected_anima(8)
0:19.198 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
bloodlust, backdraft, redirected_anima(8)
0:21.745 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
bloodlust, backdraft, redirected_anima(8)
0:22.751 aoe G immolate enemy2 49252.0/50000: 99% mana
2.8/5: 56% soul_shard
bloodlust, backdraft, redirected_anima(8)
0:23.758 aoe D rain_of_fire Fluffy_Pillow 49005.5/50000: 98% mana
3.1/5: 62% soul_shard
bloodlust, backdraft, redirected_anima(8)
0:24.764 aoe G immolate enemy3 49508.5/50000: 99% mana
0.3/5: 6% soul_shard
bloodlust, backdraft, redirected_anima(8)
0:25.771 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.7/5: 14% soul_shard
bloodlust, backdraft, redirected_anima(8)
0:26.710 aoe K conflagrate Fluffy_Pillow 48722.0/50000: 97% mana
1.1/5: 22% soul_shard
bloodlust, redirected_anima(8)
0:27.717 aoe L incinerate Fluffy_Pillow 48725.5/50000: 97% mana
1.8/5: 36% soul_shard
bloodlust, backdraft, redirected_anima(8)
0:28.656 aoe K conflagrate Fluffy_Pillow 48195.0/50000: 96% mana
2.6/5: 52% soul_shard
bloodlust, redirected_anima(8)
0:29.905 aoe D rain_of_fire Fluffy_Pillow 48319.5/50000: 97% mana
3.6/5: 72% soul_shard
bloodlust, backdraft, redirected_anima(8)
0:30.912 aoe L incinerate Fluffy_Pillow 48823.0/50000: 98% mana
0.8/5: 16% soul_shard
bloodlust, backdraft, redirected_anima(8)
0:31.851 default A cataclysm Fluffy_Pillow 48292.5/50000: 97% mana
1.6/5: 32% soul_shard
bloodlust, redirected_anima(8)
0:33.191 aoe L incinerate Fluffy_Pillow 48462.5/50000: 97% mana
1.9/5: 38% soul_shard
bloodlust
0:34.532 aoe L incinerate Fluffy_Pillow 48133.0/50000: 96% mana
2.8/5: 56% soul_shard
bloodlust
0:35.873 aoe I havoc enemy2 47803.5/50000: 96% mana
3.4/5: 68% soul_shard
bloodlust, redirected_anima
0:36.932 havoc N conflagrate Fluffy_Pillow 47333.0/50000: 95% mana
3.4/5: 68% soul_shard
bloodlust, redirected_anima
0:37.939 havoc Q chaos_bolt Fluffy_Pillow 47336.5/50000: 95% mana
4.7/5: 94% soul_shard
bloodlust, backdraft, redirected_anima
0:39.344 havoc Q chaos_bolt Fluffy_Pillow 48039.0/50000: 96% mana
2.7/5: 54% soul_shard
bloodlust, redirected_anima
0:41.353 havoc R incinerate Fluffy_Pillow 49043.5/50000: 98% mana
1.0/5: 20% soul_shard
redirected_anima(2)
0:43.092 havoc N conflagrate Fluffy_Pillow 48913.0/50000: 98% mana
1.7/5: 34% soul_shard
redirected_anima(2)
0:44.399 havoc P immolate Fluffy_Pillow 49066.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft, redirected_anima(3)
0:45.706 havoc Q chaos_bolt Fluffy_Pillow 48970.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft, redirected_anima(3)
0:47.534 default 9 soul_fire Fluffy_Pillow 49884.0/50000: 100% mana
1.4/5: 28% soul_shard
redirected_anima(3)
0:51.010 aoe F channel_demonfire Fluffy_Pillow 49001.5/50000: 98% mana
2.7/5: 54% soul_shard
redirected_anima(3)
0:53.949 aoe G immolate enemy3 49721.0/50000: 99% mana
3.1/5: 62% soul_shard
redirected_anima(4)
0:55.257 aoe G immolate enemy2 49253.0/50000: 99% mana
3.4/5: 68% soul_shard
redirected_anima(4)
0:56.565 aoe J rain_of_fire Fluffy_Pillow 49157.0/50000: 98% mana
3.4/5: 68% soul_shard
redirected_anima(4)
0:57.872 aoe K conflagrate Fluffy_Pillow 49810.5/50000: 100% mana
0.8/5: 16% soul_shard
redirected_anima(4)
0:59.178 aoe L incinerate Fluffy_Pillow 49963.5/50000: 100% mana
1.3/5: 26% soul_shard
backdraft, redirected_anima(4)
1:00.398 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.8/5: 36% soul_shard
redirected_anima(4)
1:01.706 aoe L incinerate Fluffy_Pillow 49156.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft, redirected_anima(4)
1:02.926 aoe E soul_rot Fluffy_Pillow 48766.5/50000: 98% mana
2.8/5: 56% soul_shard
redirected_anima(4)
1:04.233 default A cataclysm Fluffy_Pillow 49170.0/50000: 98% mana
2.8/5: 56% soul_shard
soul_rot, redirected_anima(4)
1:05.972 aoe I havoc enemy2 49501.5/50000: 99% mana
3.1/5: 62% soul_shard
soul_rot, redirected_anima(11)
1:07.277 havoc Q chaos_bolt Fluffy_Pillow 49154.0/50000: 98% mana
3.1/5: 62% soul_shard
soul_rot, redirected_anima(11)
1:09.888 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
soul_rot, redirected_anima(10)
1:11.197 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
backdraft, soul_rot, redirected_anima(10)
1:13.024 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
redirected_anima(10)
1:14.765 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
redirected_anima(9)
1:16.505 havoc P immolate Fluffy_Pillow 48872.5/50000: 98% mana
2.4/5: 48% soul_shard
redirected_anima(9)
1:17.810 havoc N conflagrate Fluffy_Pillow 48775.0/50000: 98% mana
2.4/5: 48% soul_shard
redirected_anima(9)
1:19.115 aoe F channel_demonfire Fluffy_Pillow 48927.5/50000: 98% mana
3.7/5: 74% soul_shard
backdraft, redirected_anima(9)
1:22.011 aoe J rain_of_fire Fluffy_Pillow 49625.5/50000: 99% mana
4.1/5: 82% soul_shard
backdraft, redirected_anima(8)
1:23.319 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
backdraft, redirected_anima(8)
1:24.539 aoe G immolate enemy3 49002.5/50000: 98% mana
1.7/5: 34% soul_shard
redirected_anima(8)
1:25.842 aoe K conflagrate Fluffy_Pillow 48904.0/50000: 98% mana
1.7/5: 34% soul_shard
redirected_anima(8)
1:27.147 aoe L incinerate Fluffy_Pillow 49056.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft, redirected_anima(8)
1:28.369 aoe L incinerate Fluffy_Pillow 48667.5/50000: 97% mana
2.8/5: 56% soul_shard
redirected_anima(8)
1:30.110 aoe J rain_of_fire Fluffy_Pillow 48538.0/50000: 97% mana
3.4/5: 68% soul_shard
redirected_anima(8)
1:31.416 aoe L incinerate Fluffy_Pillow 49191.0/50000: 98% mana
0.7/5: 14% soul_shard
redirected_anima(8)
1:33.156 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
redirected_anima(8)
1:34.896 aoe K conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
1.4/5: 28% soul_shard
redirected_anima
1:36.203 default A cataclysm Fluffy_Pillow 49025.5/50000: 98% mana
1.9/5: 38% soul_shard
backdraft, redirected_anima
1:37.944 default 9 soul_fire Fluffy_Pillow 49396.0/50000: 99% mana
2.5/5: 50% soul_shard
backdraft, redirected_anima
1:41.422 aoe F channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
3.9/5: 78% soul_shard
backdraft, redirected_anima
1:44.245 aoe I havoc enemy2 49664.0/50000: 99% mana
4.2/5: 84% soul_shard
backdraft, redirected_anima(2)
1:45.553 havoc Q chaos_bolt Fluffy_Pillow 49318.0/50000: 99% mana
4.3/5: 86% soul_shard
redirected_anima(2)
1:48.162 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
redirected_anima(2)
1:49.469 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.9/5: 78% soul_shard
backdraft, redirected_anima(2)
1:51.297 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.2/5: 44% soul_shard
redirected_anima(2)
1:53.907 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
redirected_anima(2)
1:55.213 aoe K conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
0.6/5: 12% soul_shard
redirected_anima(2)
1:56.519 aoe G immolate enemy3 49405.0/50000: 99% mana
1.7/5: 34% soul_shard
backdraft, redirected_anima(2)
1:57.824 aoe L incinerate Fluffy_Pillow 49251.5/50000: 99% mana
1.9/5: 38% soul_shard
backdraft, redirected_anima(2)
1:59.043 aoe L incinerate Fluffy_Pillow 48861.0/50000: 98% mana
2.2/5: 44% soul_shard
redirected_anima(2)
2:00.783 aoe K conflagrate Fluffy_Pillow 48731.0/50000: 97% mana
2.6/5: 52% soul_shard
redirected_anima(2)
2:02.088 aoe J rain_of_fire Fluffy_Pillow 48883.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft, redirected_anima(2)
2:03.392 aoe F channel_demonfire Fluffy_Pillow 49535.5/50000: 99% mana
0.4/5: 8% soul_shard
backdraft, redirected_anima
2:06.159 aoe E soul_rot Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft, redirected_anima
2:07.467 aoe L incinerate Fluffy_Pillow 49753.0/50000: 100% mana
0.8/5: 16% soul_shard
backdraft, soul_rot, redirected_anima
2:08.687 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
soul_rot, redirected_anima(9)
2:10.427 aoe K conflagrate Fluffy_Pillow 49372.5/50000: 99% mana
1.5/5: 30% soul_shard
soul_rot, redirected_anima(10)
2:11.733 aoe L incinerate Fluffy_Pillow 49525.5/50000: 99% mana
2.0/5: 40% soul_shard
backdraft, soul_rot, redirected_anima(10)
2:12.954 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
2.2/5: 44% soul_shard
soul_rot, redirected_anima(10)
2:14.696 aoe I havoc enemy2 48874.0/50000: 98% mana
2.8/5: 56% soul_shard
soul_rot, redirected_anima(9)
2:16.002 havoc Q chaos_bolt Fluffy_Pillow 48527.0/50000: 97% mana
3.3/5: 66% soul_shard
redirected_anima(9)
2:18.611 havoc N conflagrate Fluffy_Pillow 49831.5/50000: 100% mana
1.6/5: 32% soul_shard
redirected_anima(9)
2:19.917 havoc P immolate Fluffy_Pillow 49984.5/50000: 100% mana
2.6/5: 52% soul_shard
backdraft, redirected_anima(9)
2:21.224 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
2.9/5: 58% soul_shard
backdraft, redirected_anima(10)
2:23.054 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
redirected_anima(10)
2:24.795 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
redirected_anima(10)
2:26.534 havoc N conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
2.3/5: 46% soul_shard
redirected_anima(10)
2:27.841 default 9 soul_fire Fluffy_Pillow 49025.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft, redirected_anima(10)
2:31.319 aoe F channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, redirected_anima(10)
2:34.089 aoe G immolate enemy3 49637.5/50000: 99% mana
5.0/5: 100% soul_shard
backdraft, redirected_anima(10)
2:35.397 aoe G immolate enemy2 49253.0/50000: 99% mana
5.0/5: 100% soul_shard
backdraft, redirected_anima(10)
2:36.705 aoe J rain_of_fire Fluffy_Pillow 49157.0/50000: 98% mana
5.0/5: 100% soul_shard
redirected_anima(10)
2:38.011 aoe K conflagrate Fluffy_Pillow 49810.0/50000: 100% mana
2.1/5: 42% soul_shard
redirected_anima(2)
2:39.317 aoe L incinerate Fluffy_Pillow 49963.0/50000: 100% mana
2.9/5: 58% soul_shard
backdraft, redirected_anima(2)
2:40.535 default A cataclysm Fluffy_Pillow 49001.5/50000: 98% mana
3.1/5: 62% soul_shard
redirected_anima
2:42.273 aoe J rain_of_fire Fluffy_Pillow 49370.5/50000: 99% mana
3.4/5: 68% soul_shard
redirected_anima
2:43.580 aoe K conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
redirected_anima
2:44.963 aoe I havoc enemy2 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
backdraft, redirected_anima
2:46.269 havoc R incinerate Fluffy_Pillow 49653.0/50000: 99% mana
1.3/5: 26% soul_shard
backdraft, redirected_anima
2:47.488 havoc R incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.9/5: 38% soul_shard
redirected_anima
2:49.230 havoc Q chaos_bolt Fluffy_Pillow 48873.0/50000: 98% mana
2.4/5: 48% soul_shard
redirected_anima
2:51.840 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
2:53.579 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.5/5: 30% soul_shard
2:54.886 havoc P immolate Fluffy_Pillow 49155.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
2:56.192 aoe F channel_demonfire Fluffy_Pillow 49058.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
2:59.018 aoe J rain_of_fire Fluffy_Pillow 49721.0/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
3:00.326 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
backdraft
3:01.544 aoe G immolate enemy3 49001.5/50000: 98% mana
1.1/5: 22% soul_shard
3:02.850 aoe K conflagrate Fluffy_Pillow 48904.5/50000: 98% mana
1.3/5: 26% soul_shard
3:04.157 aoe L incinerate Fluffy_Pillow 49058.0/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
3:05.377 cds M summon_infernal Fluffy_Pillow 48668.0/50000: 97% mana
2.3/5: 46% soul_shard
3:06.683 aoe L incinerate Fluffy_Pillow 48321.0/50000: 97% mana
2.6/5: 52% soul_shard
3:08.422 aoe D rain_of_fire Fluffy_Pillow 48190.5/50000: 96% mana
3.5/5: 70% soul_shard
3:09.728 aoe E soul_rot Fluffy_Pillow 48843.5/50000: 98% mana
0.9/5: 18% soul_shard
3:11.033 aoe K conflagrate Fluffy_Pillow 49246.0/50000: 98% mana
1.4/5: 28% soul_shard
soul_rot
3:12.340 default A cataclysm Fluffy_Pillow 49399.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft, soul_rot, redirected_anima(8)
3:14.081 aoe L incinerate Fluffy_Pillow 49502.5/50000: 99% mana
2.8/5: 56% soul_shard
backdraft, soul_rot, redirected_anima(8)
3:15.302 aoe I havoc enemy2 49003.0/50000: 98% mana
3.3/5: 66% soul_shard
soul_rot, redirected_anima(8)
3:16.607 havoc O soul_fire Fluffy_Pillow 48655.5/50000: 97% mana
3.9/5: 78% soul_shard
soul_rot, redirected_anima(8)
3:20.085 havoc Q chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
redirected_anima(8)
3:22.694 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
redirected_anima(8)
3:24.000 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
backdraft, redirected_anima(8)
3:25.829 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
redirected_anima(8)
3:28.706 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.0/5: 80% soul_shard
redirected_anima(8)
3:30.012 aoe K conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
redirected_anima(8)
3:31.319 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
backdraft, redirected_anima(9)
3:32.625 aoe G immolate enemy3 49252.0/50000: 99% mana
2.7/5: 54% soul_shard
backdraft, redirected_anima(9)
3:33.932 aoe D rain_of_fire Fluffy_Pillow 49155.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft, redirected_anima(9)
3:35.239 aoe G immolate enemy2 49809.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft, redirected_anima(9)
3:36.546 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.9/5: 18% soul_shard
backdraft, redirected_anima(9)
3:37.766 aoe K conflagrate Fluffy_Pillow 48862.5/50000: 98% mana
1.1/5: 22% soul_shard
redirected_anima(9)
3:39.071 aoe L incinerate Fluffy_Pillow 49015.0/50000: 98% mana
1.8/5: 36% soul_shard
backdraft, redirected_anima(9)
3:40.291 aoe L incinerate Fluffy_Pillow 48625.0/50000: 97% mana
2.1/5: 42% soul_shard
redirected_anima(9)
3:42.032 aoe L incinerate Fluffy_Pillow 48495.5/50000: 97% mana
2.6/5: 52% soul_shard
redirected_anima
3:43.772 aoe L incinerate Fluffy_Pillow 48365.5/50000: 97% mana
2.9/5: 58% soul_shard
redirected_anima
3:45.511 default A cataclysm Fluffy_Pillow 48235.0/50000: 96% mana
3.3/5: 66% soul_shard
redirected_anima
3:47.252 aoe I havoc enemy2 48605.5/50000: 97% mana
3.7/5: 74% soul_shard
redirected_anima
3:48.559 havoc N conflagrate Fluffy_Pillow 48259.0/50000: 97% mana
3.8/5: 76% soul_shard
redirected_anima
3:49.865 havoc Q chaos_bolt Fluffy_Pillow 48412.0/50000: 97% mana
5.0/5: 100% soul_shard
backdraft, redirected_anima
3:51.692 havoc Q chaos_bolt Fluffy_Pillow 49325.5/50000: 99% mana
3.0/5: 60% soul_shard
redirected_anima
3:54.304 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
redirected_anima
3:55.608 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
backdraft, redirected_anima
3:57.436 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
redirected_anima
3:58.741 aoe F channel_demonfire Fluffy_Pillow 49251.5/50000: 99% mana
0.8/5: 16% soul_shard
redirected_anima
4:01.566 aoe K conflagrate Fluffy_Pillow 49914.0/50000: 100% mana
1.2/5: 24% soul_shard
4:02.871 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
backdraft
4:04.090 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.3/5: 46% soul_shard
4:05.832 default 9 soul_fire Fluffy_Pillow 48873.0/50000: 98% mana
2.7/5: 54% soul_shard
4:09.309 aoe G immolate enemy2 49002.0/50000: 98% mana
4.2/5: 84% soul_shard
redirected_anima
4:10.616 aoe G immolate Fluffy_Pillow 48905.5/50000: 98% mana
4.4/5: 88% soul_shard
redirected_anima
4:11.921 aoe E soul_rot Fluffy_Pillow 48808.0/50000: 98% mana
4.5/5: 90% soul_shard
redirected_anima
4:13.228 aoe G immolate enemy3 49211.5/50000: 98% mana
4.7/5: 94% soul_shard
soul_rot, redirected_anima
4:14.536 aoe J rain_of_fire Fluffy_Pillow 49115.5/50000: 98% mana
4.7/5: 94% soul_shard
soul_rot, redirected_anima(9)
4:15.843 aoe K conflagrate Fluffy_Pillow 49769.0/50000: 100% mana
1.9/5: 38% soul_shard
soul_rot, redirected_anima(9)
4:17.148 default A cataclysm Fluffy_Pillow 49921.5/50000: 100% mana
2.5/5: 50% soul_shard
backdraft, soul_rot, redirected_anima(9)
4:18.988 aoe I havoc enemy2 49502.5/50000: 99% mana
2.8/5: 56% soul_shard
backdraft, soul_rot, redirected_anima(9)
4:20.295 havoc Q chaos_bolt Fluffy_Pillow 49156.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft, soul_rot, redirected_anima(9)
4:22.122 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
redirected_anima(9)
4:23.428 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
backdraft, redirected_anima(9)
4:25.256 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
redirected_anima(9)
4:26.996 havoc R incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
redirected_anima(9)
4:28.737 havoc N conflagrate Fluffy_Pillow 48872.5/50000: 98% mana
2.3/5: 46% soul_shard
redirected_anima(9)
4:30.043 havoc P immolate Fluffy_Pillow 49025.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft, redirected_anima(9)
4:31.352 aoe F channel_demonfire Fluffy_Pillow 48930.0/50000: 98% mana
3.6/5: 72% soul_shard
backdraft, redirected_anima(9)
4:34.330 aoe G immolate enemy2 49669.0/50000: 99% mana
3.9/5: 78% soul_shard
backdraft, redirected_anima(9)
4:35.637 aoe J rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
4.0/5: 80% soul_shard
backdraft, redirected_anima(9)
4:36.944 aoe L incinerate Fluffy_Pillow 49906.0/50000: 100% mana
1.1/5: 22% soul_shard
backdraft, redirected_anima(8)
4:38.165 aoe G immolate enemy3 49003.0/50000: 98% mana
1.4/5: 28% soul_shard
redirected_anima(8)
4:39.472 aoe K conflagrate Fluffy_Pillow 48906.5/50000: 98% mana
1.6/5: 32% soul_shard
redirected_anima(8)
4:40.778 aoe L incinerate Fluffy_Pillow 49059.5/50000: 98% mana
2.2/5: 44% soul_shard
backdraft, redirected_anima(8)
4:41.999 aoe L incinerate Fluffy_Pillow 48670.0/50000: 97% mana
2.6/5: 52% soul_shard
redirected_anima(8)
4:43.740 aoe J rain_of_fire Fluffy_Pillow 48540.5/50000: 97% mana
3.0/5: 60% soul_shard
4:45.045 aoe K conflagrate Fluffy_Pillow 49193.0/50000: 98% mana
0.1/5: 2% soul_shard
4:46.351 aoe L incinerate Fluffy_Pillow 49346.0/50000: 99% mana
0.8/5: 16% soul_shard
backdraft, redirected_anima
4:47.570 aoe L incinerate Fluffy_Pillow 48955.5/50000: 98% mana
1.1/5: 22% soul_shard
redirected_anima
4:49.313 default A cataclysm Fluffy_Pillow 48827.0/50000: 98% mana
1.5/5: 30% soul_shard
redirected_anima
4:51.054 aoe I havoc enemy2 49197.5/50000: 98% mana
1.8/5: 36% soul_shard
redirected_anima
4:52.362 havoc Q chaos_bolt Fluffy_Pillow 48851.5/50000: 98% mana
2.0/5: 40% soul_shard
redirected_anima
4:54.972 havoc O soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
redirected_anima
4:58.451 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
2.8/5: 56% soul_shard
redirected_anima
4:59.757 havoc P immolate Fluffy_Pillow 49156.0/50000: 98% mana
4.1/5: 82% soul_shard
backdraft, redirected_anima
5:01.065 havoc Q chaos_bolt Fluffy_Pillow 49060.0/50000: 98% mana
4.1/5: 82% soul_shard
backdraft, redirected_anima
5:02.893 havoc N conflagrate Fluffy_Pillow 49974.0/50000: 100% mana
2.4/5: 48% soul_shard
redirected_anima
5:04.200 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
3.6/5: 72% soul_shard
backdraft, redirected_anima
5:06.974 aoe J rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.0/5: 80% soul_shard
backdraft, redirected_anima
5:08.282 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
backdraft, redirected_anima
5:09.503 aoe G immolate enemy3 49003.0/50000: 98% mana
1.5/5: 30% soul_shard
redirected_anima
5:10.809 aoe K conflagrate Fluffy_Pillow 48906.0/50000: 98% mana
1.5/5: 30% soul_shard
redirected_anima
5:12.116 aoe L incinerate Fluffy_Pillow 49059.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, redirected_anima
5:13.336 aoe E soul_rot Fluffy_Pillow 48669.5/50000: 97% mana
2.6/5: 52% soul_shard
redirected_anima
5:14.643 aoe G immolate Fluffy_Pillow 49073.0/50000: 98% mana
2.8/5: 56% soul_shard
soul_rot, redirected_anima
5:15.947 aoe G immolate enemy2 48975.0/50000: 98% mana
2.9/5: 58% soul_shard
soul_rot, redirected_anima(8)
5:17.254 aoe J rain_of_fire Fluffy_Pillow 48878.5/50000: 98% mana
3.1/5: 62% soul_shard
soul_rot, redirected_anima(8)
5:18.562 aoe L incinerate Fluffy_Pillow 49532.5/50000: 99% mana
0.2/5: 4% soul_shard
soul_rot, redirected_anima(8)
5:20.303 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.7/5: 14% soul_shard
soul_rot, redirected_anima(8)
5:21.608 default A cataclysm Fluffy_Pillow 49155.0/50000: 98% mana
1.2/5: 24% soul_shard
backdraft, soul_rot, redirected_anima(8)

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="NightFae_Niya"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=night_fae
soulbind=322721/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Venthyr_Nadjia : 9740 dps, 5203 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9739.9 9739.9 17.8 / 0.183% 838.6 / 8.6% 20.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
418.1 414.4 Mana 0.00% 38.9 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Nadjia 9740
Cataclysm 779 8.0% 9.7 32.36sec 24016 14408 Direct 29.1 6700 13386 8002 19.5%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.69 29.07 0.00 0.00 1.6669 0.0000 232742.91 232742.91 0.00% 14407.76 14407.76
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.47% 23.40 11 33 6700.40 6141 7261 6699.14 6467 6915 156759 156759 0.00%
crit 19.53% 5.68 1 13 13385.67 12283 14521 13381.39 12524 14391 75984 75984 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.75
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1081) 0.0% (11.1%) 12.8 24.13sec 25147 9483

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.84 0.00 191.79 0.00 2.6517 0.1606 0.00 0.00 0.00% 9483.45 9483.45

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.85
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1081 11.1% 0.0 0.00sec 0 0 Direct 575.4 471 940 561 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 575.38 0.00 0.00 0.0000 0.0000 322930.44 322930.44 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 464.53 335 599 470.76 263 976 470.80 449 494 218666 218666 0.00%
crit 19.27% 110.85 70 161 940.19 525 1952 940.62 819 1076 104265 104265 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1369 (1852) 14.1% (19.0%) 22.7 12.96sec 24311 12528 Direct 45.2 (90.0) 0 9034 9034 100.0% (59.9%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.72 45.23 0.00 0.00 1.9407 0.0000 408529.26 408529.26 0.00% 12527.69 12527.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 45.23 28 60 9033.56 5861 12241 9033.42 8825 9262 408529 408529 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.83
  • if_expr:cast_time<havoc_remains
    Internal Combustion 482 4.9% 44.7 12.98sec 3216 0 Direct 44.7 2691 5388 3215 19.4%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.74 44.74 0.00 0.00 0.0000 0.0000 143866.77 143866.77 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.57% 36.04 21 51 2691.49 5 3715 2692.51 2503 2906 97010 97010 0.00%
crit 19.43% 8.69 1 19 5387.90 2 7430 5390.98 3394 6571 46856 46856 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 823 8.5% 37.8 7.78sec 6508 5321 Direct 56.6 3638 7284 4340 19.3%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.76 56.62 0.00 0.00 1.2232 0.0000 245755.92 245755.92 0.00% 5320.89 5320.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.75% 45.72 31 60 3637.96 2047 5042 3637.30 3364 3896 166302 166302 0.00%
crit 19.25% 10.90 3 21 7283.67 4095 10084 7291.10 5618 9103 79453 79453 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.90
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.85
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1652 17.0% 28.2 10.50sec 17532 14212 Direct 35.5 1541 3067 1835 19.3%
Periodic 354.9 1012 2024 1208 19.4% 95.8%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.17 35.49 354.87 354.87 1.2336 2.4230 493903.01 493903.01 0.00% 552.10 14211.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 28.65 18 41 1540.66 819 2017 1540.79 1395 1663 44140 44140 0.00%
crit 19.27% 6.84 0 14 3067.35 1638 4033 3065.26 0 3987 20987 20987 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.62% 286.10 215 359 1012.25 0 1261 1012.32 982 1038 289610 289610 0.00%
crit 19.38% 68.76 41 96 2024.17 1 2521 2023.64 1911 2128 139166 139166 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:19.77
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.51
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Impending Catastrophe 0 (233) 0.0% (2.4%) 4.6 64.74sec 14959 9558

Stats Details: Impending Catastrophe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.64 0.00 0.00 0.00 1.5651 0.0000 0.00 0.00 0.00% 9558.01 9558.01

Action Details: Impending Catastrophe

  • id:321792
  • school:shadow
  • range:40.0
  • travel_speed:16.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:321792
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.

Action Priority List

    aoe
    [K]:4.68
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    Impending Catastrophe (_impact) 31 0.3% 0.0 0.00sec 0 0 Direct 13.8 558 1116 666 19.4%

Stats Details: Impending Catastrophe Impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 13.84 0.00 0.00 0.0000 0.0000 9222.10 9222.10 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.58% 11.15 6 17 558.02 558 558 558.02 558 558 6222 6222 0.00%
crit 19.42% 2.69 0 9 1116.04 1116 1116 1057.12 0 1116 3000 3000 0.00%

Action Details: Impending Catastrophe Impact

  • id:322167
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:322167
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
    Impending Catastrophe (_dot) 202 2.1% 0.0 0.00sec 0 0 Periodic 106.1 476 951 567 19.3% 18.2%

Stats Details: Impending Catastrophe Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 106.13 106.13 0.0000 1.5410 60188.18 60188.18 0.00% 368.02 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.74% 85.70 64 109 475.68 38 488 475.62 456 486 40759 40759 0.00%
crit 19.26% 20.44 10 37 950.80 76 977 950.23 761 977 19430 19430 0.00%

Action Details: Impending Catastrophe Dot

  • id:322170
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.175000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322170
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
Incinerate 598 6.2% 43.1 6.20sec 4154 2922 Direct 54.1 (54.1) 2773 5551 3310 19.3% (19.3%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.13 54.14 0.00 0.00 1.4218 0.0000 179170.00 179170.00 0.00% 2921.74 2921.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 43.69 27 66 2772.98 1320 3426 2774.28 2537 2974 121143 121143 0.00%
crit 19.30% 10.45 2 21 5551.33 2759 6852 5561.62 4108 6551 58027 58027 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:31.92
    havoc
    [R]:11.41
  • if_expr:cast_time<havoc_remains
Rain of Fire 890 9.1% 17.0 16.75sec 15653 12763 Periodic 403.0 553 1105 660 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.98 0.00 0.00 403.00 1.2265 0.0000 265769.83 265769.83 0.00% 12762.67 12762.67
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.68% 325.13 207 443 552.76 507 599 552.77 546 560 179721 179721 0.00%
crit 19.32% 77.86 45 116 1105.19 1013 1198 1105.10 1080 1129 86048 86048 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.28
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.69
Soul Fire 513 5.3% 5.5 49.65sec 27819 8056 Direct 7.6 16896 33687 20228 20.0%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.52 7.58 0.00 0.00 3.4531 0.0000 153426.39 153426.39 0.00% 8056.42 8056.42
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.03% 6.07 2 10 16895.62 8610 21177 16916.48 13431 20196 102422 102422 0.00%
crit 19.97% 1.51 0 6 33687.37 17264 42348 27833.52 0 42348 51004 51004 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.46
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.15
  • if_expr:cast_time<havoc_remains
Summon Infernal 81 0.8% 2.0 180.92sec 11895 10286 Direct 6.0 3348 6696 3966 18.4%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23790.51 23790.51 0.00% 10285.56 10285.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.57% 4.89 1 6 3348.13 3348 3348 3348.13 3348 3348 16387 16387 0.00%
crit 18.43% 1.11 0 5 6696.27 6696 6696 4628.46 0 6696 7403 7403 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3510 / 714
Immolation 3244 6.7% 39.0 5.50sec 4991 0 Direct 117.0 1395 2790 1663 19.3%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194660.57 194660.57 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 94.46 82 105 1395.06 1395 1395 1395.06 1395 1395 131783 131783 0.00%
crit 19.26% 22.54 12 35 2790.11 2790 2790 2790.11 2790 2790 62878 62878 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 266 0.5% 41.0 5.26sec 389 271 Direct 41.0 326 651 389 19.6%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15957.79 22794.10 29.99% 270.91 270.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.44% 32.98 26 39 325.55 326 326 325.55 326 326 10737 15337 29.99%
crit 19.56% 8.02 2 15 651.10 651 651 651.10 651 651 5220 7457 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 524 / 524
Firebolt 524 5.4% 94.9 3.15sec 1650 1153 Direct 94.2 1395 2790 1663 19.2%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.95 94.22 0.00 0.00 1.4303 0.0000 156650.31 156650.31 0.00% 1153.49 1153.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.82% 76.15 53 96 1395.06 1395 1395 1395.06 1395 1395 106232 106232 0.00%
crit 19.18% 18.07 5 31 2790.11 2790 2790 2790.11 2790 2790 50418 50418 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:95.41
Simple Action Stats Execute Interval
Venthyr_Nadjia
Havoc 9.6 32.32sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.61 0.00 0.00 0.00 1.2222 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.62
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.8 0.0 7.8sec 7.8sec 4.2sec 53.62% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 22.3s
  • trigger_min/max:1.9s / 22.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:53.62%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.56% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.56%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Euphoria 3.4 0.0 78.0sec 78.0sec 9.9sec 11.23% 0.00% 0.0 (0.0) 3.3

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_euphoria
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:78.0s / 78.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 10.0s

Stack Uptimes

  • euphoria_1:11.23%

Spelldata

  • id:331937
  • name:Euphoria
  • tooltip:Filled with the thrill of battle, increasing Haste by $w1%.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Thrill Seeker 4.4 144.6 78.0sec 2.0sec 66.2sec 97.05% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_thrill_seeker
  • max_stacks:40
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:2.0s / 2.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 76.0s

Stack Uptimes

  • thrill_seeker_1:2.94%
  • thrill_seeker_3:2.93%
  • thrill_seeker_4:2.91%
  • thrill_seeker_5:2.88%
  • thrill_seeker_6:2.85%
  • thrill_seeker_7:2.83%
  • thrill_seeker_8:2.81%
  • thrill_seeker_9:2.78%
  • thrill_seeker_10:2.75%
  • thrill_seeker_11:2.72%
  • thrill_seeker_12:2.70%
  • thrill_seeker_13:2.67%
  • thrill_seeker_14:2.65%
  • thrill_seeker_15:2.62%
  • thrill_seeker_16:2.60%
  • thrill_seeker_17:2.58%
  • thrill_seeker_18:2.56%
  • thrill_seeker_19:2.54%
  • thrill_seeker_20:2.52%
  • thrill_seeker_21:2.50%
  • thrill_seeker_22:2.48%
  • thrill_seeker_23:2.46%
  • thrill_seeker_24:2.44%
  • thrill_seeker_25:2.43%
  • thrill_seeker_26:2.42%
  • thrill_seeker_27:2.41%
  • thrill_seeker_28:2.41%
  • thrill_seeker_29:2.39%
  • thrill_seeker_30:2.38%
  • thrill_seeker_31:2.37%
  • thrill_seeker_32:2.35%
  • thrill_seeker_33:2.34%
  • thrill_seeker_34:2.32%
  • thrill_seeker_35:2.31%
  • thrill_seeker_36:2.31%
  • thrill_seeker_37:2.30%
  • thrill_seeker_38:2.29%
  • thrill_seeker_39:2.28%

Spelldata

  • id:331939
  • name:Thrill Seeker
  • tooltip:At {$u=40} stacks, you will gain Euphoria.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:40
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
infernal - infernal: Embers 2.0 0.0 180.9sec 180.9sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 186.8s
  • trigger_min/max:180.0s / 186.8s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.9sec 180.9sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 186.8s
  • trigger_min/max:180.0s / 186.8s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 10.63% 7.35% 14.02% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Nadjia
soul_fire Soul Shard 6.52 7.19 7.51% 1.10 0.46 6.01%
immolate Soul Shard 354.85 34.28 35.83% 0.10 1.21 3.41%
incinerate Soul Shard 43.12 10.89 11.38% 0.25 0.01 0.06%
conflagrate Soul Shard 37.75 28.30 29.59% 0.75 0.00 0.00%
mana_regen Mana 682.25 123946.33 100.00% 181.67 25298.29 16.95%
immolate_crits Soul Shard 34.64 3.35 3.50% 0.10 0.12 3.41%
incinerate_crits Soul Shard 10.47 1.05 1.09% 0.10 0.00 0.01%
infernal Soul Shard 120.00 10.62 11.10% 0.09 1.38 11.52%
pet - imp
energy_regen Energy 371.01 3627.69 100.00% 9.78 22.74 0.62%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 414.43 418.06 25303.1 48913.6 45946.0 50000.0
Soul Shard 4.0 0.32 0.32 3.2 2.3 0.1 5.0
Usage Type Count Total Avg RPE APR
Venthyr_Nadjia
cataclysm Mana 9.7 4849.5 500.0 500.4 48.0
channel_demonfire Mana 12.8 9634.2 750.0 750.2 33.5
chaos_bolt Soul Shard 22.7 45.4 2.0 2.0 12163.7
conflagrate Mana 37.8 18876.8 500.0 499.9 13.0
havoc Mana 9.6 9616.2 1000.0 1000.5 0.0
immolate Mana 28.2 21126.4 750.0 749.9 23.4
impending_catastrophe Mana 4.6 9298.0 2000.0 2003.9 7.5
incinerate Mana 43.1 43117.0 1000.0 999.7 4.2
rain_of_fire Soul Shard 17.0 50.9 3.0 3.0 5218.4
soul_fire Mana 6.5 6517.9 1000.0 1181.8 23.5
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 11.9
pet - imp
firebolt Energy 94.9 3797.9 40.0 40.0 41.2

Statistics & Data Analysis

Fight Length
Venthyr_Nadjia Fight Length
Count 625
Mean 299.05
Minimum 240.24
Maximum 359.94
Spread ( max - min ) 119.70
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Venthyr_Nadjia Damage Per Second
Count 625
Mean 9739.88
Minimum 9032.70
Maximum 10448.13
Spread ( max - min ) 1415.43
Range [ ( max - min ) / 2 * 100% ] 7.27%
Standard Deviation 226.7754
5th Percentile 9407.91
95th Percentile 10151.70
( 95th Percentile - 5th Percentile ) 743.79
Mean Distribution
Standard Deviation 9.0710
95.00% Confidence Interval ( 9722.10 - 9757.66 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2083
0.1 Scale Factor Error with Delta=300 440
0.05 Scale Factor Error with Delta=300 1757
0.01 Scale Factor Error with Delta=300 43902
Priority Target DPS
Venthyr_Nadjia Priority Target Damage Per Second
Count 625
Mean 5202.72
Minimum 4867.25
Maximum 5675.77
Spread ( max - min ) 808.52
Range [ ( max - min ) / 2 * 100% ] 7.77%
Standard Deviation 131.1969
5th Percentile 5010.36
95th Percentile 5443.53
( 95th Percentile - 5th Percentile ) 433.17
Mean Distribution
Standard Deviation 5.2479
95.00% Confidence Interval ( 5192.44 - 5213.01 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2443
0.1 Scale Factor Error with Delta=300 147
0.05 Scale Factor Error with Delta=300 588
0.01 Scale Factor Error with Delta=300 14694
DPS(e)
Venthyr_Nadjia Damage Per Second (Effective)
Count 625
Mean 9739.88
Minimum 9032.70
Maximum 10448.13
Spread ( max - min ) 1415.43
Range [ ( max - min ) / 2 * 100% ] 7.27%
Damage
Venthyr_Nadjia Damage
Count 625
Mean 2539295.34
Minimum 2020642.89
Maximum 3054950.74
Spread ( max - min ) 1034307.86
Range [ ( max - min ) / 2 * 100% ] 20.37%
DTPS
Venthyr_Nadjia Damage Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Nadjia Healing Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Nadjia Healing Per Second (Effective)
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Nadjia Heal
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Nadjia Healing Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Nadjia Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_NadjiaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Nadjia Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.46 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.75 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.28 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.85 channel_demonfire,if=dot.immolate.remains>cast_time
F 19.77 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.62 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.69 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.90 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
K 4.68 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 31.92 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.85 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.15 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.51 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.83 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 11.41 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHQNQNPQNQNDEFFDFKLJLDJLALIEHNQRNPOILFJIELJLLALIHRNQRNPREIJFKLLLIJ9AHQRNQRNPEFILFJLLLJILAHRNQRQP9EJFIKFLJLJIAHRRNQRRPEJILLFMJLDLL9AEHQNQNPQNDKFLFEFIJLAJHQRNQRPRN9EFIJLILLAHNQRNQRPEFJKFILJLLLLA9EHQNQNPQNFILLEFJ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.741 aoe E channel_demonfire Fluffy_Pillow 49370.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.924 cds M summon_infernal Fluffy_Pillow 49712.0/50000: 99% mana
4.3/5: 86% soul_shard
bloodlust, thrill_seeker
0:04.932 aoe H havoc enemy2 49216.0/50000: 98% mana
4.5/5: 90% soul_shard
bloodlust, thrill_seeker(3)
0:05.937 havoc Q chaos_bolt Fluffy_Pillow 48718.5/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust, thrill_seeker(3)
0:07.946 havoc N conflagrate Fluffy_Pillow 49723.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust, thrill_seeker(4)
0:08.953 havoc Q chaos_bolt Fluffy_Pillow 49726.5/50000: 99% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, thrill_seeker(5)
0:10.359 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust, thrill_seeker(6)
0:11.365 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.0/5: 80% soul_shard
bloodlust, backdraft, thrill_seeker(6)
0:12.371 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, thrill_seeker(7)
0:13.778 havoc N conflagrate Fluffy_Pillow 49955.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, thrill_seeker(7)
0:14.785 havoc Q chaos_bolt Fluffy_Pillow 49959.0/50000: 100% mana
4.4/5: 88% soul_shard
bloodlust, backdraft, thrill_seeker(8)
0:16.191 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust, thrill_seeker(9)
0:17.199 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft, thrill_seeker(9)
0:18.206 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
bloodlust, backdraft, thrill_seeker(10)
0:20.673 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
bloodlust, backdraft, thrill_seeker(11)
0:21.679 aoe F immolate enemy2 49252.0/50000: 99% mana
2.7/5: 54% soul_shard
bloodlust, backdraft, thrill_seeker(11)
0:22.685 aoe D rain_of_fire Fluffy_Pillow 49005.0/50000: 98% mana
3.1/5: 62% soul_shard
bloodlust, backdraft, thrill_seeker(12)
0:23.691 aoe F immolate enemy3 49508.0/50000: 99% mana
0.3/5: 6% soul_shard
bloodlust, backdraft, thrill_seeker(12)
0:24.697 aoe K impending_catastrophe Fluffy_Pillow 49252.0/50000: 99% mana
0.7/5: 14% soul_shard
bloodlust, backdraft, thrill_seeker(13)
0:26.036 aoe L incinerate Fluffy_Pillow 47921.5/50000: 96% mana
1.1/5: 22% soul_shard
bloodlust, backdraft, thrill_seeker(14)
0:26.975 aoe J conflagrate Fluffy_Pillow 47391.0/50000: 95% mana
1.9/5: 38% soul_shard
bloodlust, thrill_seeker(14)
0:27.982 aoe L incinerate Fluffy_Pillow 47394.5/50000: 95% mana
2.7/5: 54% soul_shard
bloodlust, backdraft, thrill_seeker(14)
0:28.920 aoe D rain_of_fire Fluffy_Pillow 46863.5/50000: 94% mana
3.2/5: 64% soul_shard
bloodlust, thrill_seeker(15)
0:29.928 aoe J conflagrate Fluffy_Pillow 47367.5/50000: 95% mana
0.6/5: 12% soul_shard
bloodlust, thrill_seeker(15)
0:30.934 aoe L incinerate Fluffy_Pillow 47370.5/50000: 95% mana
1.7/5: 34% soul_shard
bloodlust, backdraft, thrill_seeker(16)
0:31.875 default A cataclysm Fluffy_Pillow 46841.0/50000: 94% mana
2.1/5: 42% soul_shard
bloodlust, thrill_seeker(16)
0:33.217 aoe L incinerate Fluffy_Pillow 47012.0/50000: 94% mana
2.6/5: 52% soul_shard
bloodlust, thrill_seeker(17)
0:34.559 aoe I rain_of_fire Fluffy_Pillow 46683.0/50000: 93% mana
3.2/5: 64% soul_shard
bloodlust, thrill_seeker(18)
0:35.565 aoe E channel_demonfire Fluffy_Pillow 47186.0/50000: 94% mana
0.4/5: 8% soul_shard
bloodlust, thrill_seeker(18)
0:37.919 aoe H havoc enemy2 47613.0/50000: 95% mana
0.9/5: 18% soul_shard
bloodlust, thrill_seeker(19)
0:38.925 havoc N conflagrate Fluffy_Pillow 47116.0/50000: 94% mana
1.2/5: 24% soul_shard
bloodlust, thrill_seeker(20)
0:39.933 havoc Q chaos_bolt Fluffy_Pillow 47120.0/50000: 94% mana
2.3/5: 46% soul_shard
bloodlust, backdraft, thrill_seeker(20)
0:41.338 havoc R incinerate Fluffy_Pillow 47822.5/50000: 96% mana
0.5/5: 10% soul_shard
thrill_seeker(21)
0:43.079 havoc N conflagrate Fluffy_Pillow 47693.0/50000: 95% mana
1.4/5: 28% soul_shard
thrill_seeker(22)
0:44.384 havoc P immolate Fluffy_Pillow 47845.5/50000: 96% mana
2.5/5: 50% soul_shard
backdraft, thrill_seeker(23)
0:45.690 havoc O soul_fire Fluffy_Pillow 47748.5/50000: 95% mana
2.7/5: 54% soul_shard
backdraft, thrill_seeker(23)
0:49.167 aoe I rain_of_fire Fluffy_Pillow 48487.0/50000: 97% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(25)
0:50.473 aoe L incinerate Fluffy_Pillow 49140.0/50000: 98% mana
2.1/5: 42% soul_shard
backdraft, thrill_seeker(26)
0:51.692 aoe F immolate enemy3 48749.5/50000: 97% mana
2.5/5: 50% soul_shard
thrill_seeker(26)
0:53.000 aoe J conflagrate Fluffy_Pillow 48653.5/50000: 97% mana
2.7/5: 54% soul_shard
thrill_seeker(27)
0:54.306 aoe I rain_of_fire Fluffy_Pillow 48806.5/50000: 98% mana
3.4/5: 68% soul_shard
backdraft, thrill_seeker(28)
0:55.612 aoe E channel_demonfire Fluffy_Pillow 49459.5/50000: 99% mana
0.5/5: 10% soul_shard
backdraft, thrill_seeker(28)
0:58.399 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
backdraft, thrill_seeker(30)
0:59.619 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
thrill_seeker(30)
1:00.926 aoe L incinerate Fluffy_Pillow 49156.0/50000: 98% mana
1.8/5: 36% soul_shard
backdraft, thrill_seeker(31)
1:02.146 aoe L incinerate Fluffy_Pillow 48766.0/50000: 98% mana
2.2/5: 44% soul_shard
thrill_seeker(32)
1:03.888 default A cataclysm Fluffy_Pillow 48637.0/50000: 97% mana
2.8/5: 56% soul_shard
thrill_seeker(32)
1:05.629 aoe L incinerate Fluffy_Pillow 49007.5/50000: 98% mana
2.9/5: 58% soul_shard
thrill_seeker(33)
1:07.370 aoe I rain_of_fire Fluffy_Pillow 48878.0/50000: 98% mana
3.3/5: 66% soul_shard
thrill_seeker(34)
1:08.675 aoe H havoc enemy2 49530.5/50000: 99% mana
0.4/5: 8% soul_shard
thrill_seeker(35)
1:09.979 havoc R incinerate Fluffy_Pillow 49182.5/50000: 98% mana
0.7/5: 14% soul_shard
thrill_seeker(35)
1:11.719 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
thrill_seeker(36)
1:13.026 havoc Q chaos_bolt Fluffy_Pillow 49155.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft, thrill_seeker(37)
1:14.854 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
thrill_seeker(38)
1:16.594 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
thrill_seeker(39)
1:17.898 havoc P immolate Fluffy_Pillow 49154.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, thrill_seeker(39)
1:19.204 havoc R incinerate Fluffy_Pillow 49057.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft, euphoria
1:20.222 aoe E channel_demonfire Fluffy_Pillow 48566.0/50000: 97% mana
3.1/5: 62% soul_shard
thrill_seeker, euphoria
1:22.565 aoe I rain_of_fire Fluffy_Pillow 48987.5/50000: 98% mana
3.7/5: 74% soul_shard
thrill_seeker(3), euphoria
1:23.655 aoe J conflagrate Fluffy_Pillow 49532.5/50000: 99% mana
0.9/5: 18% soul_shard
thrill_seeker(3), euphoria
1:24.744 aoe F immolate enemy3 49577.0/50000: 99% mana
1.5/5: 30% soul_shard
backdraft, thrill_seeker(4), euphoria
1:25.836 aoe K impending_catastrophe Fluffy_Pillow 49253.5/50000: 99% mana
1.7/5: 34% soul_shard
backdraft, thrill_seeker(4), euphoria
1:27.484 aoe L incinerate Fluffy_Pillow 48002.0/50000: 96% mana
1.8/5: 36% soul_shard
backdraft, thrill_seeker(5), euphoria
1:28.500 aoe L incinerate Fluffy_Pillow 47510.0/50000: 95% mana
2.2/5: 44% soul_shard
thrill_seeker(6)
1:30.241 aoe L incinerate Fluffy_Pillow 47380.5/50000: 95% mana
2.7/5: 54% soul_shard
thrill_seeker(7)
1:31.982 aoe I rain_of_fire Fluffy_Pillow 47251.0/50000: 95% mana
3.0/5: 60% soul_shard
thrill_seeker(7)
1:33.290 aoe J conflagrate Fluffy_Pillow 47905.0/50000: 96% mana
0.2/5: 4% soul_shard
thrill_seeker(8)
1:34.597 default 9 soul_fire Fluffy_Pillow 48058.5/50000: 96% mana
0.8/5: 16% soul_shard
backdraft, thrill_seeker(9)
1:38.075 default A cataclysm Fluffy_Pillow 48797.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft, thrill_seeker(11)
1:39.816 aoe H havoc enemy2 49168.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft, thrill_seeker(11)
1:41.120 havoc Q chaos_bolt Fluffy_Pillow 48820.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft, thrill_seeker(12)
1:42.948 havoc R incinerate Fluffy_Pillow 49734.0/50000: 99% mana
0.9/5: 18% soul_shard
thrill_seeker(13)
1:44.689 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.5/5: 30% soul_shard
thrill_seeker(14)
1:45.995 havoc Q chaos_bolt Fluffy_Pillow 49155.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft, thrill_seeker(14)
1:47.824 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
thrill_seeker(15)
1:49.565 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
thrill_seeker(16)
1:50.871 havoc P immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft, thrill_seeker(17)
1:52.178 aoe E channel_demonfire Fluffy_Pillow 49059.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft, thrill_seeker(18)
1:55.099 aoe F immolate enemy2 49769.5/50000: 100% mana
3.3/5: 66% soul_shard
backdraft, thrill_seeker(19)
1:56.407 aoe I rain_of_fire Fluffy_Pillow 49253.0/50000: 99% mana
3.5/5: 70% soul_shard
backdraft, thrill_seeker(20)
1:57.713 aoe L incinerate Fluffy_Pillow 49906.0/50000: 100% mana
0.5/5: 10% soul_shard
backdraft, thrill_seeker(20)
1:58.933 aoe F immolate enemy3 49002.5/50000: 98% mana
0.9/5: 18% soul_shard
thrill_seeker(21)
2:00.240 aoe J conflagrate Fluffy_Pillow 48906.0/50000: 98% mana
1.0/5: 20% soul_shard
thrill_seeker(22)
2:01.547 aoe L incinerate Fluffy_Pillow 49059.5/50000: 98% mana
1.7/5: 34% soul_shard
backdraft, thrill_seeker(22)
2:02.767 aoe L incinerate Fluffy_Pillow 48669.5/50000: 97% mana
2.0/5: 40% soul_shard
thrill_seeker(23)
2:04.507 aoe L incinerate Fluffy_Pillow 48539.5/50000: 97% mana
2.5/5: 50% soul_shard
thrill_seeker(24)
2:06.249 aoe J conflagrate Fluffy_Pillow 48410.5/50000: 97% mana
2.8/5: 56% soul_shard
thrill_seeker(25)
2:07.555 aoe I rain_of_fire Fluffy_Pillow 48563.5/50000: 97% mana
3.6/5: 72% soul_shard
backdraft, thrill_seeker(25)
2:08.862 aoe L incinerate Fluffy_Pillow 49217.0/50000: 98% mana
0.8/5: 16% soul_shard
backdraft, thrill_seeker(26)
2:10.083 default A cataclysm Fluffy_Pillow 48827.5/50000: 98% mana
1.2/5: 24% soul_shard
thrill_seeker(27)
2:11.826 aoe H havoc enemy2 49199.0/50000: 98% mana
1.6/5: 32% soul_shard
thrill_seeker(27)
2:13.133 havoc R incinerate Fluffy_Pillow 48852.5/50000: 98% mana
1.7/5: 34% soul_shard
thrill_seeker(28)
2:14.873 havoc N conflagrate Fluffy_Pillow 48722.5/50000: 97% mana
2.4/5: 48% soul_shard
thrill_seeker(29)
2:16.178 havoc Q chaos_bolt Fluffy_Pillow 48875.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft, thrill_seeker(30)
2:18.005 havoc R incinerate Fluffy_Pillow 49788.5/50000: 100% mana
1.8/5: 36% soul_shard
thrill_seeker(31)
2:19.745 havoc Q chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
thrill_seeker(31)
2:22.357 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
thrill_seeker(33)
2:23.664 default 9 soul_fire Fluffy_Pillow 49252.5/50000: 99% mana
0.9/5: 18% soul_shard
thrill_seeker(33)
2:27.140 aoe E channel_demonfire Fluffy_Pillow 49001.5/50000: 98% mana
2.2/5: 44% soul_shard
thrill_seeker(35)
2:29.874 aoe J conflagrate Fluffy_Pillow 49618.5/50000: 99% mana
2.5/5: 50% soul_shard
thrill_seeker(36)
2:31.180 aoe F immolate enemy3 49771.5/50000: 100% mana
3.4/5: 68% soul_shard
backdraft, thrill_seeker(37)
2:32.487 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.4/5: 68% soul_shard
backdraft, thrill_seeker(38)
2:33.793 aoe K impending_catastrophe Fluffy_Pillow 49905.5/50000: 100% mana
0.7/5: 14% soul_shard
backdraft, thrill_seeker(38)
2:35.536 aoe F immolate enemy2 48003.5/50000: 96% mana
1.0/5: 20% soul_shard
backdraft, thrill_seeker(39)
2:36.841 aoe L incinerate Fluffy_Pillow 47906.0/50000: 96% mana
1.0/5: 20% soul_shard
backdraft, euphoria
2:37.857 aoe J conflagrate Fluffy_Pillow 47414.0/50000: 95% mana
1.3/5: 26% soul_shard
euphoria
2:38.945 aoe L incinerate Fluffy_Pillow 47458.0/50000: 95% mana
2.0/5: 40% soul_shard
backdraft, thrill_seeker, euphoria
2:39.961 aoe J conflagrate Fluffy_Pillow 46966.0/50000: 94% mana
2.3/5: 46% soul_shard
thrill_seeker, euphoria
2:41.050 aoe I rain_of_fire Fluffy_Pillow 47010.5/50000: 94% mana
3.1/5: 62% soul_shard
backdraft, thrill_seeker(3), euphoria
2:42.141 default A cataclysm Fluffy_Pillow 47556.0/50000: 95% mana
0.2/5: 4% soul_shard
backdraft, thrill_seeker(4), euphoria
2:43.592 aoe H havoc enemy2 47781.5/50000: 96% mana
0.4/5: 8% soul_shard
backdraft, thrill_seeker(4), euphoria
2:44.682 havoc R incinerate Fluffy_Pillow 47326.5/50000: 95% mana
0.7/5: 14% soul_shard
backdraft, thrill_seeker(5), euphoria
2:45.698 havoc R incinerate Fluffy_Pillow 46834.5/50000: 94% mana
1.1/5: 22% soul_shard
thrill_seeker(5), euphoria
2:47.148 havoc N conflagrate Fluffy_Pillow 46559.5/50000: 93% mana
1.8/5: 36% soul_shard
thrill_seeker(6)
2:48.454 havoc Q chaos_bolt Fluffy_Pillow 46712.5/50000: 93% mana
2.8/5: 56% soul_shard
backdraft, thrill_seeker(7)
2:50.280 havoc R incinerate Fluffy_Pillow 47625.5/50000: 95% mana
1.1/5: 22% soul_shard
thrill_seeker(8)
2:52.020 havoc R incinerate Fluffy_Pillow 47495.5/50000: 95% mana
1.8/5: 36% soul_shard
thrill_seeker(9)
2:53.761 havoc P immolate Fluffy_Pillow 47366.0/50000: 95% mana
2.2/5: 44% soul_shard
thrill_seeker(9)
2:55.070 aoe E channel_demonfire Fluffy_Pillow 47270.5/50000: 95% mana
2.5/5: 50% soul_shard
thrill_seeker(10)
2:57.885 aoe J conflagrate Fluffy_Pillow 47928.0/50000: 96% mana
2.8/5: 56% soul_shard
thrill_seeker(11)
2:59.192 aoe I rain_of_fire Fluffy_Pillow 48081.5/50000: 96% mana
3.3/5: 66% soul_shard
backdraft, thrill_seeker(12)
3:00.499 aoe L incinerate Fluffy_Pillow 48735.0/50000: 97% mana
0.6/5: 12% soul_shard
backdraft, thrill_seeker(13)
3:01.720 aoe L incinerate Fluffy_Pillow 48345.5/50000: 97% mana
0.8/5: 16% soul_shard
thrill_seeker(13)
3:03.459 aoe F immolate enemy3 48215.0/50000: 96% mana
1.3/5: 26% soul_shard
thrill_seeker(14)
3:04.765 cds M summon_infernal Fluffy_Pillow 48118.0/50000: 96% mana
1.4/5: 28% soul_shard
thrill_seeker(15)
3:06.072 aoe J conflagrate Fluffy_Pillow 47771.5/50000: 96% mana
1.8/5: 36% soul_shard
thrill_seeker(16)
3:07.379 aoe L incinerate Fluffy_Pillow 47925.0/50000: 96% mana
2.7/5: 54% soul_shard
backdraft, thrill_seeker(16)
3:08.599 aoe D rain_of_fire Fluffy_Pillow 47535.0/50000: 95% mana
3.3/5: 66% soul_shard
thrill_seeker(17)
3:09.906 aoe L incinerate Fluffy_Pillow 48188.5/50000: 96% mana
0.6/5: 12% soul_shard
thrill_seeker(17)
3:11.646 aoe L incinerate Fluffy_Pillow 48058.5/50000: 96% mana
1.4/5: 28% soul_shard
thrill_seeker(18)
3:13.386 default 9 soul_fire Fluffy_Pillow 47928.5/50000: 96% mana
2.3/5: 46% soul_shard
thrill_seeker(19)
3:16.862 default A cataclysm Fluffy_Pillow 48666.5/50000: 97% mana
4.4/5: 88% soul_shard
thrill_seeker(21)
3:18.602 aoe E channel_demonfire Fluffy_Pillow 49036.5/50000: 98% mana
5.0/5: 100% soul_shard
thrill_seeker(22)
3:21.442 aoe H havoc enemy2 49706.5/50000: 99% mana
5.0/5: 100% soul_shard
thrill_seeker(23)
3:22.749 havoc Q chaos_bolt Fluffy_Pillow 49360.0/50000: 99% mana
5.0/5: 100% soul_shard
thrill_seeker(24)
3:25.359 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
thrill_seeker(25)
3:26.666 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
backdraft, thrill_seeker(26)
3:28.494 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
thrill_seeker(27)
3:29.799 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
backdraft, thrill_seeker(27)
3:31.107 havoc Q chaos_bolt Fluffy_Pillow 49253.0/50000: 99% mana
4.9/5: 98% soul_shard
backdraft, thrill_seeker(28)
3:32.933 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
thrill_seeker(29)
3:34.240 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft, thrill_seeker(30)
3:35.548 aoe K impending_catastrophe Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
backdraft, thrill_seeker(30)
3:37.289 aoe F immolate enemy3 48002.5/50000: 96% mana
2.1/5: 42% soul_shard
backdraft, thrill_seeker(31)
3:38.595 aoe L incinerate Fluffy_Pillow 47905.5/50000: 96% mana
2.2/5: 44% soul_shard
backdraft, thrill_seeker(32)
3:39.815 aoe F immolate enemy2 47515.5/50000: 95% mana
2.6/5: 52% soul_shard
thrill_seeker(32)
3:41.122 aoe E channel_demonfire Fluffy_Pillow 47419.0/50000: 95% mana
2.6/5: 52% soul_shard
thrill_seeker(33)
3:44.056 aoe F immolate Fluffy_Pillow 48136.0/50000: 96% mana
3.1/5: 62% soul_shard
thrill_seeker(35)
3:45.363 aoe I rain_of_fire Fluffy_Pillow 48039.5/50000: 96% mana
3.4/5: 68% soul_shard
thrill_seeker(35)
3:46.669 aoe J conflagrate Fluffy_Pillow 48692.5/50000: 97% mana
0.5/5: 10% soul_shard
thrill_seeker(36)
3:47.974 aoe L incinerate Fluffy_Pillow 48845.0/50000: 98% mana
1.2/5: 24% soul_shard
backdraft, thrill_seeker(36)
3:49.193 default A cataclysm Fluffy_Pillow 48454.5/50000: 97% mana
1.5/5: 30% soul_shard
thrill_seeker(37)
3:50.933 aoe J conflagrate Fluffy_Pillow 48824.5/50000: 98% mana
1.7/5: 34% soul_shard
thrill_seeker(38)
3:52.241 aoe H havoc enemy2 48978.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, thrill_seeker(39)
3:53.549 havoc Q chaos_bolt Fluffy_Pillow 48632.5/50000: 97% mana
2.6/5: 52% soul_shard
backdraft, thrill_seeker(39)
3:55.376 havoc R incinerate Fluffy_Pillow 49546.0/50000: 99% mana
0.9/5: 18% soul_shard
euphoria
3:56.827 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.8/5: 36% soul_shard
thrill_seeker, euphoria
3:57.916 havoc Q chaos_bolt Fluffy_Pillow 49046.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft, thrill_seeker, euphoria
3:59.438 havoc R incinerate Fluffy_Pillow 49807.5/50000: 100% mana
1.2/5: 24% soul_shard
thrill_seeker(3), euphoria
4:00.890 havoc P immolate Fluffy_Pillow 49002.5/50000: 98% mana
1.8/5: 36% soul_shard
thrill_seeker(4), euphoria
4:01.979 havoc R incinerate Fluffy_Pillow 48797.0/50000: 98% mana
1.9/5: 38% soul_shard
thrill_seeker(4), euphoria
4:03.430 havoc N conflagrate Fluffy_Pillow 48522.5/50000: 97% mana
2.7/5: 54% soul_shard
thrill_seeker(5), euphoria
4:04.519 default 9 soul_fire Fluffy_Pillow 48567.0/50000: 97% mana
3.8/5: 76% soul_shard
backdraft, thrill_seeker(6)
4:07.998 aoe E channel_demonfire Fluffy_Pillow 49003.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(7)
4:10.926 aoe F immolate enemy3 49717.0/50000: 99% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(9)
4:12.233 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
5.0/5: 100% soul_shard
backdraft, thrill_seeker(10)
4:13.538 aoe J conflagrate Fluffy_Pillow 49905.0/50000: 100% mana
2.3/5: 46% soul_shard
thrill_seeker(10)
4:14.845 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft, thrill_seeker(11)
4:16.066 aoe I rain_of_fire Fluffy_Pillow 49003.0/50000: 98% mana
3.3/5: 66% soul_shard
thrill_seeker(12)
4:17.372 aoe L incinerate Fluffy_Pillow 49656.0/50000: 99% mana
0.3/5: 6% soul_shard
thrill_seeker(12)
4:19.112 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
thrill_seeker(13)
4:20.852 default A cataclysm Fluffy_Pillow 48872.0/50000: 98% mana
1.3/5: 26% soul_shard
thrill_seeker(14)
4:22.671 aoe H havoc enemy2 49281.5/50000: 99% mana
1.6/5: 32% soul_shard
thrill_seeker(15)
4:23.977 havoc N conflagrate Fluffy_Pillow 48934.5/50000: 98% mana
1.8/5: 36% soul_shard
thrill_seeker(15)
4:25.283 havoc Q chaos_bolt Fluffy_Pillow 49087.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft, thrill_seeker(16)
4:27.111 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
thrill_seeker(17)
4:28.853 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.8/5: 36% soul_shard
thrill_seeker(18)
4:30.158 havoc Q chaos_bolt Fluffy_Pillow 49155.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft, thrill_seeker(19)
4:31.986 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
thrill_seeker(19)
4:33.727 havoc P immolate Fluffy_Pillow 49002.5/50000: 98% mana
1.8/5: 36% soul_shard
thrill_seeker(20)
4:35.034 aoe E channel_demonfire Fluffy_Pillow 48906.0/50000: 98% mana
1.8/5: 36% soul_shard
thrill_seeker(21)
4:37.843 aoe F immolate enemy2 49560.5/50000: 99% mana
2.0/5: 40% soul_shard
thrill_seeker(22)
4:39.149 aoe J conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
2.3/5: 46% soul_shard
thrill_seeker(23)
4:40.455 aoe K impending_catastrophe Fluffy_Pillow 49405.0/50000: 99% mana
2.8/5: 56% soul_shard
backdraft, thrill_seeker(24)
4:42.196 aoe F immolate enemy3 48002.5/50000: 96% mana
3.1/5: 62% soul_shard
backdraft, thrill_seeker(25)
4:43.502 aoe I rain_of_fire Fluffy_Pillow 47905.5/50000: 96% mana
3.1/5: 62% soul_shard
backdraft, thrill_seeker(25)
4:44.810 aoe L incinerate Fluffy_Pillow 48559.5/50000: 97% mana
0.4/5: 8% soul_shard
backdraft, thrill_seeker(26)
4:46.031 aoe J conflagrate Fluffy_Pillow 48170.0/50000: 96% mana
0.6/5: 12% soul_shard
thrill_seeker(27)
4:47.395 aoe L incinerate Fluffy_Pillow 48352.0/50000: 97% mana
1.4/5: 28% soul_shard
backdraft, thrill_seeker(27)
4:48.613 aoe L incinerate Fluffy_Pillow 47961.0/50000: 96% mana
1.6/5: 32% soul_shard
thrill_seeker(28)
4:50.352 aoe L incinerate Fluffy_Pillow 47830.5/50000: 96% mana
2.2/5: 44% soul_shard
thrill_seeker(29)
4:52.093 aoe L incinerate Fluffy_Pillow 47701.0/50000: 95% mana
2.6/5: 52% soul_shard
thrill_seeker(30)
4:53.832 default A cataclysm Fluffy_Pillow 47570.5/50000: 95% mana
2.9/5: 58% soul_shard
thrill_seeker(30)
4:55.573 default 9 soul_fire Fluffy_Pillow 47941.0/50000: 96% mana
3.3/5: 66% soul_shard
thrill_seeker(31)
4:59.050 aoe E channel_demonfire Fluffy_Pillow 48679.5/50000: 97% mana
4.7/5: 94% soul_shard
thrill_seeker(33)
5:01.859 aoe H havoc enemy2 49334.0/50000: 99% mana
5.0/5: 100% soul_shard
thrill_seeker(34)
5:03.165 havoc Q chaos_bolt Fluffy_Pillow 48987.0/50000: 98% mana
5.0/5: 100% soul_shard
thrill_seeker(35)
5:05.773 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
thrill_seeker(36)
5:07.080 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.1/5: 82% soul_shard
backdraft, thrill_seeker(37)
5:08.907 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
thrill_seeker(38)
5:10.214 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.6/5: 72% soul_shard
backdraft, thrill_seeker(39)
5:11.521 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
3.7/5: 74% soul_shard
backdraft, thrill_seeker(39)
5:13.348 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
euphoria
5:14.439 aoe F immolate enemy3 50000.0/50000: 100% mana
3.1/5: 62% soul_shard
backdraft, thrill_seeker, euphoria
5:15.529 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.3/5: 66% soul_shard
backdraft, thrill_seeker, euphoria
5:16.617 aoe L incinerate Fluffy_Pillow 49796.5/50000: 100% mana
0.6/5: 12% soul_shard
backdraft, thrill_seeker(3), euphoria
5:17.635 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
1.0/5: 20% soul_shard
thrill_seeker(3), euphoria
5:19.088 aoe E channel_demonfire Fluffy_Pillow 48729.5/50000: 97% mana
1.4/5: 28% soul_shard
thrill_seeker(4), euphoria
5:21.742 aoe F immolate enemy2 49306.5/50000: 99% mana
1.8/5: 36% soul_shard
thrill_seeker(5), euphoria
5:22.833 aoe J conflagrate Fluffy_Pillow 49102.0/50000: 98% mana
2.0/5: 40% soul_shard
thrill_seeker(6)

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Venthyr_Nadjia"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=venthyr
soulbind=331586/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Venthyr_Theotar : 9725 dps, 5189 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9724.5 9724.5 18.0 / 0.185% 841.5 / 8.7% 20.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
410.0 406.8 Mana 0.00% 38.1 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Theotar 9725
Cataclysm 797 8.2% 9.7 32.41sec 24680 14526 Direct 29.0 6888 13777 8222 19.4%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.65 28.95 0.00 0.00 1.6991 0.0000 238190.54 238190.54 0.00% 14526.47 14526.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.56% 23.32 15 33 6887.85 6141 8767 6887.63 6522 7388 160662 160662 0.00%
crit 19.44% 5.63 0 17 13776.53 12283 17534 13689.83 0 16934 77529 77529 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.71
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1058) 0.0% (10.9%) 12.2 25.39sec 25863 9596

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.22 0.00 182.51 0.00 2.6952 0.1635 0.00 0.00 0.00% 9596.13 9596.13

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.22
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1058 10.9% 0.0 0.00sec 0 0 Direct 547.5 483 969 577 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 547.52 0.00 0.00 0.0000 0.0000 315943.03 315943.03 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 441.76 321 558 483.42 263 1179 483.68 452 522 213556 213556 0.00%
crit 19.32% 105.76 68 147 968.56 525 2357 968.62 831 1114 102387 102387 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1398 (1879) 14.4% (19.3%) 22.6 13.12sec 24800 12615 Direct 44.9 (89.5) 0 9280 9280 100.0% (59.8%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.59 44.93 0.00 0.00 1.9660 0.0000 416909.91 416909.91 0.00% 12614.80 12614.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 44.93 34 58 9279.55 5862 14779 9278.89 8865 9838 416910 416910 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.71
  • if_expr:cast_time<havoc_remains
    Internal Combustion 481 4.9% 44.5 13.13sec 3219 0 Direct 44.5 2703 5395 3219 19.2%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.55 44.54 0.00 0.00 0.0000 0.0000 143376.37 143376.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.84% 36.01 23 51 2703.40 9 4483 2704.51 2478 2943 97343 97343 0.00%
crit 19.16% 8.53 1 18 5395.40 2 8904 5384.23 3880 7579 46033 46033 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 823 8.5% 37.0 7.95sec 6648 5320 Direct 55.5 3720 7440 4427 18.9%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.96 55.55 0.00 0.00 1.2497 0.0000 245740.65 245740.65 0.00% 5319.98 5319.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.06% 45.02 30 60 3720.27 2047 6088 3720.57 3468 4056 167467 167467 0.00%
crit 18.94% 10.52 3 21 7439.71 4095 12165 7453.61 5500 10185 78274 78274 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.42
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.53
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1653 17.0% 28.0 10.36sec 17618 13941 Direct 35.0 1580 3152 1887 19.5%
Periodic 344.9 1041 2082 1241 19.2% 95.4%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.04 35.00 344.93 344.93 1.2637 2.4818 494057.51 494057.51 0.00% 554.19 13941.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.52% 28.19 18 39 1579.77 819 2433 1579.81 1358 1737 44527 44527 0.00%
crit 19.48% 6.82 0 15 3151.97 1645 4862 3137.19 0 4288 21483 21483 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.75% 278.54 209 347 1040.58 0 1522 1040.56 1013 1084 289832 289832 0.00%
crit 19.25% 66.39 39 101 2082.06 10 3044 2081.60 1933 2220 138216 138216 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:19.94
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.21
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Impending Catastrophe 0 (228) 0.0% (2.3%) 4.7 64.66sec 14590 8818

Stats Details: Impending Catastrophe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.66 0.00 0.00 0.00 1.6547 0.0000 0.00 0.00 0.00% 8818.04 8818.04

Action Details: Impending Catastrophe

  • id:321792
  • school:shadow
  • range:40.0
  • travel_speed:16.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:321792
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.

Action Priority List

    aoe
    [K]:4.70
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    Impending Catastrophe (_impact) 31 0.3% 0.0 0.00sec 0 0 Direct 13.9 558 1116 666 19.4%

Stats Details: Impending Catastrophe Impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 13.89 0.00 0.00 0.0000 0.0000 9251.57 9251.57 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 11.19 5 17 558.02 558 558 558.02 558 558 6246 6246 0.00%
crit 19.39% 2.69 0 8 1116.04 1116 1116 1057.12 0 1116 3005 3005 0.00%

Action Details: Impending Catastrophe Impact

  • id:322167
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:322167
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
    Impending Catastrophe (_dot) 197 2.0% 0.0 0.00sec 0 0 Periodic 101.8 484 967 578 19.4% 18.3%

Stats Details: Impending Catastrophe Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 101.75 101.75 0.0000 1.6134 58770.82 58770.82 0.00% 358.00 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.56% 81.97 63 110 483.60 446 488 483.60 482 487 39640 39640 0.00%
crit 19.44% 19.78 9 32 967.13 891 977 967.26 941 977 19131 19131 0.00%

Action Details: Impending Catastrophe Dot

  • id:322170
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.175000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322170
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
Incinerate 592 6.1% 41.6 6.48sec 4264 2915 Direct 52.3 (52.3) 2844 5721 3397 19.3% (19.3%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.65 52.26 0.00 0.00 1.4629 0.0000 177597.81 177597.81 0.00% 2914.78 2914.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 42.19 25 65 2844.03 1351 4137 2846.40 2589 3128 119989 119989 0.00%
crit 19.26% 10.07 2 22 5721.36 2699 8273 5722.93 3460 7041 57609 57609 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:30.89
    havoc
    [R]:10.99
  • if_expr:cast_time<havoc_remains
Rain of Fire 874 9.0% 16.3 17.32sec 16068 12872 Periodic 385.6 568 1136 678 19.2% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.26 0.00 0.00 385.58 1.2484 0.0000 261201.94 261201.94 0.00% 12871.53 12871.53
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.77% 311.45 205 448 568.27 507 723 568.24 547 599 176968 176968 0.00%
crit 19.23% 74.14 39 118 1136.27 1013 1447 1136.41 1085 1203 84234 84234 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.17
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.08
Soul Fire 515 5.3% 5.5 49.43sec 27828 8002 Direct 7.5 17097 34081 20378 19.5%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.53 7.54 0.00 0.00 3.4775 0.0000 153831.75 153831.75 0.00% 8002.48 8002.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.49% 6.07 2 10 17096.81 8618 25569 17115.03 14227 20650 103735 103735 0.00%
crit 19.51% 1.47 0 5 34081.17 17297 50873 27785.71 0 50873 50097 50097 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.57
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.07
  • if_expr:cast_time<havoc_remains
Summon Infernal 80 0.8% 2.0 180.51sec 11850 10251 Direct 6.0 3348 6696 3950 18.0%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23699.44 23699.44 0.00% 10250.62 10250.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.03% 4.92 1 6 3348.13 3348 3348 3348.13 3348 3348 16478 16478 0.00%
crit 17.97% 1.08 0 5 6696.27 6696 6696 4607.03 0 6696 7221 7221 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3502 / 712
Immolation 3238 6.7% 39.0 5.49sec 4982 0 Direct 117.0 1395 2790 1661 19.0%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194307.90 194307.90 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.95% 94.72 83 106 1395.06 1395 1395 1395.06 1395 1395 132135 132135 0.00%
crit 19.05% 22.28 11 34 2790.11 2790 2790 2790.11 2790 2790 62173 62173 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 264 0.5% 41.0 5.25sec 386 269 Direct 41.0 326 651 387 18.7%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15838.50 22623.72 29.99% 268.89 268.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.34% 33.35 24 40 325.55 326 326 325.55 326 326 10857 15508 29.99%
crit 18.66% 7.65 1 17 651.10 651 651 651.10 651 651 4982 7116 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 513 / 513
Firebolt 513 5.3% 93.0 3.22sec 1649 1132 Direct 92.3 1395 2790 1662 19.1%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.02 92.30 0.00 0.00 1.4558 0.0000 153351.28 153351.28 0.00% 1132.40 1132.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.91% 74.68 53 94 1395.06 1395 1395 1395.06 1395 1395 104178 104178 0.00%
crit 19.09% 17.62 7 31 2790.11 2790 2790 2790.11 2790 2790 49173 49173 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.47
Simple Action Stats Execute Interval
Venthyr_Theotar
Havoc 9.6 32.24sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.61 0.00 0.00 0.00 1.2440 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.61
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.0 0.0 7.9sec 7.9sec 4.4sec 54.10% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 23.3s
  • trigger_min/max:1.9s / 23.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:54.10%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.56% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.56%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Soothing Shade 4.2 0.0 62.7sec 62.7sec 11.7sec 16.35% 0.00% 0.0 (0.0) 4.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_soothing_shade
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:525.00

Trigger Details

  • interval_min/max:20.0s / 209.9s
  • trigger_min/max:20.0s / 209.9s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 12.0s

Stack Uptimes

  • soothing_shade_1:16.35%

Spelldata

  • id:336885
  • name:Soothing Shade
  • tooltip:Standing in the shade makes it easier to focus, increasing your Mastery by $w1.
  • description:{$@spelldesc336239=Your spells and abilities have a chance to call Tubbins and Gubbins to your side for {$336808d=12 seconds}, parasol in hand. Standing in the shaded area grants you {$336885s1=525} Mastery.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 182.6s
  • trigger_min/max:180.0s / 182.6s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 182.6s
  • trigger_min/max:180.0s / 182.6s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 11.58% 8.84% 14.09% 0.8s 0.0s 6.5s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Theotar
soul_fire Soul Shard 6.54 7.20 7.73% 1.10 0.40 5.25%
immolate Soul Shard 344.95 33.23 35.69% 0.10 1.27 3.67%
incinerate Soul Shard 41.65 10.51 11.29% 0.25 0.00 0.01%
conflagrate Soul Shard 36.95 27.75 29.81% 0.75 0.00 0.00%
mana_regen Mana 653.82 121684.06 100.00% 186.11 27538.37 18.45%
immolate_crits Soul Shard 32.82 3.16 3.40% 0.10 0.12 3.63%
incinerate_crits Soul Shard 10.05 1.01 1.08% 0.10 0.00 0.00%
infernal Soul Shard 120.00 10.23 10.99% 0.09 1.77 14.72%
pet - imp
energy_regen Energy 360.01 3550.34 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 406.81 410.00 27552.7 49043.9 46841.0 50000.0
Soul Shard 4.0 0.31 0.31 3.5 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
Venthyr_Theotar
cataclysm Mana 9.7 4830.0 500.0 500.5 49.3
channel_demonfire Mana 12.2 9163.8 750.0 750.1 34.5
chaos_bolt Soul Shard 22.6 45.2 2.0 2.0 12406.5
conflagrate Mana 36.9 18474.3 500.0 499.8 13.3
havoc Mana 9.6 9613.1 1000.0 1000.5 0.0
immolate Mana 28.0 21031.6 750.0 750.0 23.5
impending_catastrophe Mana 4.7 9341.7 2000.0 2003.6 7.3
incinerate Mana 41.7 41653.7 1000.0 1000.1 4.3
rain_of_fire Soul Shard 16.2 48.7 3.0 3.0 5358.6
soul_fire Mana 6.5 6539.8 1000.0 1183.0 23.5
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 11.8
pet - imp
firebolt Energy 93.0 3720.9 40.0 40.0 41.2

Statistics & Data Analysis

Fight Length
Venthyr_Theotar Fight Length
Count 625
Mean 299.05
Minimum 240.24
Maximum 359.94
Spread ( max - min ) 119.70
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Venthyr_Theotar Damage Per Second
Count 625
Mean 9724.54
Minimum 9112.12
Maximum 10349.07
Spread ( max - min ) 1236.96
Range [ ( max - min ) / 2 * 100% ] 6.36%
Standard Deviation 229.1495
5th Percentile 9380.08
95th Percentile 10127.50
( 95th Percentile - 5th Percentile ) 747.41
Mean Distribution
Standard Deviation 9.1660
95.00% Confidence Interval ( 9706.57 - 9742.50 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2134
0.1 Scale Factor Error with Delta=300 449
0.05 Scale Factor Error with Delta=300 1794
0.01 Scale Factor Error with Delta=300 44826
Priority Target DPS
Venthyr_Theotar Priority Target Damage Per Second
Count 625
Mean 5188.93
Minimum 4863.92
Maximum 5584.82
Spread ( max - min ) 720.90
Range [ ( max - min ) / 2 * 100% ] 6.95%
Standard Deviation 132.1721
5th Percentile 4986.31
95th Percentile 5410.02
( 95th Percentile - 5th Percentile ) 423.70
Mean Distribution
Standard Deviation 5.2869
95.00% Confidence Interval ( 5178.57 - 5199.30 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2493
0.1 Scale Factor Error with Delta=300 150
0.05 Scale Factor Error with Delta=300 597
0.01 Scale Factor Error with Delta=300 14913
DPS(e)
Venthyr_Theotar Damage Per Second (Effective)
Count 625
Mean 9724.54
Minimum 9112.12
Maximum 10349.07
Spread ( max - min ) 1236.96
Range [ ( max - min ) / 2 * 100% ] 6.36%
Damage
Venthyr_Theotar Damage
Count 625
Mean 2538571.33
Minimum 2037399.81
Maximum 3086198.12
Spread ( max - min ) 1048798.30
Range [ ( max - min ) / 2 * 100% ] 20.66%
DTPS
Venthyr_Theotar Damage Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Theotar Healing Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Theotar Healing Per Second (Effective)
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Theotar Heal
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Theotar Healing Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Theotar Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_TheotarTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Theotar Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.57 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.71 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.17 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.22 channel_demonfire,if=dot.immolate.remains>cast_time
F 19.94 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.61 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.08 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.42 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
K 4.70 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 30.89 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.53 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.07 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.21 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.71 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 10.99 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHQNQNPQNQNDEFFFKDLJLJDLALJEHQQRPNQ9FJLEFIJLALJHQRQPRNEIFKLJLLJIA9HQRNQRNPEFFILJLLLAJIHRRQRRNPE9FFIJKIALHRNQNQPEJLLFJIMLLJDAHRQNOPDEDJLFLIJLKLLAHNQQPRNEILJLFL9FFIJAHQRNQRNPEFILFJLKJLLIAHNQROPNEILLFIJLLLJLA

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.742 aoe E channel_demonfire Fluffy_Pillow 49371.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:04.007 cds M summon_infernal Fluffy_Pillow 49753.5/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust
0:05.012 aoe H havoc enemy2 49256.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust
0:06.018 havoc Q chaos_bolt Fluffy_Pillow 48759.0/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust
0:08.025 havoc N conflagrate Fluffy_Pillow 49762.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:09.031 havoc Q chaos_bolt Fluffy_Pillow 49765.5/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:10.436 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:11.442 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.9/5: 78% soul_shard
bloodlust, backdraft
0:12.450 havoc Q chaos_bolt Fluffy_Pillow 49253.0/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:13.857 havoc N conflagrate Fluffy_Pillow 49956.5/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust
0:14.864 havoc Q chaos_bolt Fluffy_Pillow 49960.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:16.270 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:17.276 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.0/5: 80% soul_shard
bloodlust, backdraft
0:18.282 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
bloodlust, backdraft
0:20.680 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
bloodlust, backdraft
0:21.687 aoe F immolate enemy2 49252.5/50000: 99% mana
2.5/5: 50% soul_shard
bloodlust, backdraft
0:22.694 aoe F immolate enemy3 49006.0/50000: 98% mana
2.8/5: 56% soul_shard
bloodlust, backdraft
0:23.700 aoe K impending_catastrophe Fluffy_Pillow 48759.0/50000: 98% mana
3.0/5: 60% soul_shard
bloodlust, backdraft
0:25.040 aoe D rain_of_fire Fluffy_Pillow 47429.0/50000: 95% mana
3.5/5: 70% soul_shard
bloodlust, backdraft
0:26.047 aoe L incinerate Fluffy_Pillow 47932.5/50000: 96% mana
0.9/5: 18% soul_shard
bloodlust, backdraft
0:26.986 aoe J conflagrate Fluffy_Pillow 47402.0/50000: 95% mana
1.3/5: 26% soul_shard
bloodlust
0:27.994 aoe L incinerate Fluffy_Pillow 47406.0/50000: 95% mana
2.2/5: 44% soul_shard
bloodlust, backdraft
0:28.933 aoe J conflagrate Fluffy_Pillow 46875.5/50000: 94% mana
2.7/5: 54% soul_shard
bloodlust
0:29.939 aoe D rain_of_fire Fluffy_Pillow 46878.5/50000: 94% mana
3.7/5: 74% soul_shard
bloodlust, backdraft
0:30.947 aoe L incinerate Fluffy_Pillow 47382.5/50000: 95% mana
1.0/5: 20% soul_shard
bloodlust, backdraft
0:31.887 default A cataclysm Fluffy_Pillow 46852.5/50000: 94% mana
1.7/5: 34% soul_shard
bloodlust
0:33.227 aoe L incinerate Fluffy_Pillow 47022.5/50000: 94% mana
2.1/5: 42% soul_shard
bloodlust
0:34.564 aoe J conflagrate Fluffy_Pillow 46691.0/50000: 93% mana
2.7/5: 54% soul_shard
bloodlust
0:35.644 aoe E channel_demonfire Fluffy_Pillow 46731.0/50000: 93% mana
3.3/5: 66% soul_shard
bloodlust, backdraft
0:37.895 aoe H havoc enemy2 47106.5/50000: 94% mana
3.8/5: 76% soul_shard
bloodlust, backdraft
0:38.901 havoc Q chaos_bolt Fluffy_Pillow 46609.5/50000: 93% mana
3.9/5: 78% soul_shard
bloodlust, backdraft
0:40.309 havoc Q chaos_bolt Fluffy_Pillow 47313.5/50000: 95% mana
2.1/5: 42% soul_shard
bloodlust
0:42.316 havoc R incinerate Fluffy_Pillow 48317.0/50000: 97% mana
0.4/5: 8% soul_shard
0:44.057 havoc P immolate Fluffy_Pillow 48187.5/50000: 96% mana
1.0/5: 20% soul_shard
0:45.363 havoc N conflagrate Fluffy_Pillow 48090.5/50000: 96% mana
1.3/5: 26% soul_shard
0:46.669 havoc Q chaos_bolt Fluffy_Pillow 48243.5/50000: 96% mana
2.4/5: 48% soul_shard
backdraft
0:48.495 default 9 soul_fire Fluffy_Pillow 49156.5/50000: 98% mana
0.8/5: 16% soul_shard
0:51.972 aoe F immolate enemy3 49002.0/50000: 98% mana
2.1/5: 42% soul_shard
0:53.279 aoe J conflagrate Fluffy_Pillow 48905.5/50000: 98% mana
2.4/5: 48% soul_shard
0:54.587 aoe L incinerate Fluffy_Pillow 49059.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
0:55.806 aoe E channel_demonfire Fluffy_Pillow 48669.0/50000: 97% mana
3.4/5: 68% soul_shard
0:58.568 aoe F immolate enemy2 49300.0/50000: 99% mana
3.8/5: 76% soul_shard
0:59.874 aoe I rain_of_fire Fluffy_Pillow 49203.0/50000: 98% mana
3.9/5: 78% soul_shard
1:01.182 aoe J conflagrate Fluffy_Pillow 49857.0/50000: 100% mana
1.1/5: 22% soul_shard
1:02.487 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
backdraft
1:03.708 default A cataclysm Fluffy_Pillow 49003.0/50000: 98% mana
2.2/5: 44% soul_shard
1:05.450 aoe L incinerate Fluffy_Pillow 49374.0/50000: 99% mana
2.6/5: 52% soul_shard
1:07.191 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.8/5: 56% soul_shard
1:08.632 aoe H havoc enemy2 49223.0/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
1:09.939 havoc Q chaos_bolt Fluffy_Pillow 48876.5/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
1:11.766 havoc R incinerate Fluffy_Pillow 49790.0/50000: 100% mana
1.9/5: 38% soul_shard
1:13.505 havoc Q chaos_bolt Fluffy_Pillow 49001.5/50000: 98% mana
2.6/5: 52% soul_shard
1:16.116 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
1:17.423 havoc R incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.9/5: 18% soul_shard
1:19.164 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.7/5: 34% soul_shard
1:20.470 aoe E channel_demonfire Fluffy_Pillow 49155.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
1:23.205 aoe I rain_of_fire Fluffy_Pillow 49773.0/50000: 100% mana
3.0/5: 60% soul_shard
backdraft
1:24.510 aoe F immolate enemy3 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
backdraft
1:25.816 aoe K impending_catastrophe Fluffy_Pillow 49252.0/50000: 99% mana
0.3/5: 6% soul_shard
backdraft
1:27.557 aoe L incinerate Fluffy_Pillow 48002.5/50000: 96% mana
0.7/5: 14% soul_shard
backdraft
1:28.776 aoe J conflagrate Fluffy_Pillow 47612.0/50000: 95% mana
1.2/5: 24% soul_shard
1:30.081 aoe L incinerate Fluffy_Pillow 47764.5/50000: 96% mana
1.7/5: 34% soul_shard
backdraft
1:31.301 aoe L incinerate Fluffy_Pillow 47374.5/50000: 95% mana
2.2/5: 44% soul_shard
1:33.041 aoe J conflagrate Fluffy_Pillow 47244.5/50000: 94% mana
2.4/5: 48% soul_shard
1:34.576 aoe I rain_of_fire Fluffy_Pillow 47512.0/50000: 95% mana
3.2/5: 64% soul_shard
backdraft
1:35.883 default A cataclysm Fluffy_Pillow 48165.5/50000: 96% mana
0.5/5: 10% soul_shard
backdraft
1:37.625 default 9 soul_fire Fluffy_Pillow 48536.5/50000: 97% mana
0.6/5: 12% soul_shard
backdraft
1:41.100 aoe H havoc enemy2 49001.0/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
1:42.406 havoc Q chaos_bolt Fluffy_Pillow 48654.0/50000: 97% mana
2.3/5: 46% soul_shard
backdraft
1:44.235 havoc R incinerate Fluffy_Pillow 49568.5/50000: 99% mana
0.5/5: 10% soul_shard
1:45.974 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.2/5: 24% soul_shard
1:47.281 havoc Q chaos_bolt Fluffy_Pillow 49155.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
1:49.108 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
1:50.850 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.3/5: 26% soul_shard
1:52.156 havoc P immolate Fluffy_Pillow 49156.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
1:53.462 aoe E channel_demonfire Fluffy_Pillow 49059.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
1:56.382 aoe F immolate enemy3 49769.0/50000: 100% mana
3.0/5: 60% soul_shard
backdraft
1:57.689 aoe F immolate enemy2 49252.5/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
1:58.995 aoe I rain_of_fire Fluffy_Pillow 49155.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
2:00.301 aoe L incinerate Fluffy_Pillow 49808.5/50000: 100% mana
0.3/5: 6% soul_shard
backdraft
2:01.521 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.6/5: 12% soul_shard
2:02.827 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.3/5: 26% soul_shard
backdraft
2:04.047 aoe L incinerate Fluffy_Pillow 48765.5/50000: 98% mana
1.7/5: 34% soul_shard
2:05.787 aoe L incinerate Fluffy_Pillow 48635.5/50000: 97% mana
2.2/5: 44% soul_shard
2:07.526 default A cataclysm Fluffy_Pillow 48505.0/50000: 97% mana
2.6/5: 52% soul_shard
2:09.359 aoe J conflagrate Fluffy_Pillow 48921.5/50000: 98% mana
2.8/5: 56% soul_shard
2:10.665 aoe I rain_of_fire Fluffy_Pillow 49074.5/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
2:11.970 aoe H havoc enemy2 49727.0/50000: 99% mana
0.6/5: 12% soul_shard
backdraft
2:13.277 havoc R incinerate Fluffy_Pillow 49380.5/50000: 99% mana
0.8/5: 16% soul_shard
backdraft
2:14.497 havoc R incinerate Fluffy_Pillow 48990.5/50000: 98% mana
1.3/5: 26% soul_shard
2:16.238 havoc Q chaos_bolt Fluffy_Pillow 48861.0/50000: 98% mana
2.0/5: 40% soul_shard
2:18.848 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
2:20.587 havoc R incinerate Fluffy_Pillow 49001.5/50000: 98% mana
0.9/5: 18% soul_shard
2:22.329 havoc N conflagrate Fluffy_Pillow 48872.5/50000: 98% mana
1.6/5: 32% soul_shard
soothing_shade
2:23.634 havoc P immolate Fluffy_Pillow 49025.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft, soothing_shade
2:24.940 aoe E channel_demonfire Fluffy_Pillow 48928.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft, soothing_shade
2:27.721 default 9 soul_fire Fluffy_Pillow 49568.5/50000: 99% mana
3.4/5: 68% soul_shard
backdraft, soothing_shade
2:31.199 aoe F immolate enemy2 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, soothing_shade
2:32.506 aoe F immolate enemy3 48906.0/50000: 98% mana
5.0/5: 100% soul_shard
soothing_shade
2:33.814 aoe I rain_of_fire Fluffy_Pillow 48810.0/50000: 98% mana
5.0/5: 100% soul_shard
soothing_shade
2:35.118 aoe J conflagrate Fluffy_Pillow 49462.0/50000: 99% mana
2.3/5: 46% soul_shard
2:36.425 aoe K impending_catastrophe Fluffy_Pillow 49615.5/50000: 99% mana
2.9/5: 58% soul_shard
backdraft
2:38.165 aoe I rain_of_fire Fluffy_Pillow 48002.0/50000: 96% mana
3.1/5: 62% soul_shard
backdraft
2:39.471 default A cataclysm Fluffy_Pillow 48655.0/50000: 97% mana
0.2/5: 4% soul_shard
backdraft
2:41.212 aoe L incinerate Fluffy_Pillow 49025.5/50000: 98% mana
0.4/5: 8% soul_shard
backdraft
2:42.430 aoe H havoc enemy2 48634.5/50000: 97% mana
0.7/5: 14% soul_shard
2:43.736 havoc R incinerate Fluffy_Pillow 48287.5/50000: 97% mana
0.9/5: 18% soul_shard
2:45.476 havoc N conflagrate Fluffy_Pillow 48157.5/50000: 96% mana
1.5/5: 30% soul_shard
2:46.784 havoc Q chaos_bolt Fluffy_Pillow 48311.5/50000: 97% mana
2.7/5: 54% soul_shard
backdraft
2:48.612 havoc N conflagrate Fluffy_Pillow 49225.5/50000: 98% mana
1.1/5: 22% soul_shard
2:49.918 havoc Q chaos_bolt Fluffy_Pillow 49378.5/50000: 99% mana
2.3/5: 46% soul_shard
backdraft
2:51.746 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
2:53.054 aoe E channel_demonfire Fluffy_Pillow 49253.0/50000: 99% mana
0.6/5: 12% soul_shard
2:55.881 aoe J conflagrate Fluffy_Pillow 49916.5/50000: 100% mana
1.1/5: 22% soul_shard
2:57.188 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
backdraft
2:58.408 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.1/5: 42% soul_shard
3:00.148 aoe F immolate enemy3 48872.5/50000: 98% mana
2.6/5: 52% soul_shard
3:01.453 aoe J conflagrate Fluffy_Pillow 48775.0/50000: 98% mana
2.8/5: 56% soul_shard
3:02.760 aoe I rain_of_fire Fluffy_Pillow 48928.5/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
3:04.067 cds M summon_infernal Fluffy_Pillow 49582.0/50000: 99% mana
0.7/5: 14% soul_shard
backdraft
3:05.373 aoe L incinerate Fluffy_Pillow 49235.0/50000: 98% mana
1.0/5: 20% soul_shard
backdraft
3:06.592 aoe L incinerate Fluffy_Pillow 48844.5/50000: 98% mana
1.7/5: 34% soul_shard
3:08.333 aoe J conflagrate Fluffy_Pillow 48715.0/50000: 97% mana
2.3/5: 46% soul_shard
3:09.717 aoe D rain_of_fire Fluffy_Pillow 48907.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
3:11.024 default A cataclysm Fluffy_Pillow 49560.5/50000: 99% mana
0.8/5: 16% soul_shard
backdraft
3:12.949 aoe H havoc enemy2 49503.0/50000: 99% mana
1.6/5: 32% soul_shard
backdraft
3:14.256 havoc R incinerate Fluffy_Pillow 49156.5/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
3:15.475 havoc Q chaos_bolt Fluffy_Pillow 48766.0/50000: 98% mana
2.5/5: 50% soul_shard
3:18.085 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
soothing_shade
3:19.392 havoc O soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.1/5: 62% soul_shard
backdraft, soothing_shade
3:22.870 havoc P immolate Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, soothing_shade
3:24.177 aoe D rain_of_fire Fluffy_Pillow 48906.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, soothing_shade
3:25.483 aoe E channel_demonfire Fluffy_Pillow 49559.0/50000: 99% mana
2.2/5: 44% soul_shard
backdraft, soothing_shade
3:28.341 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.1/5: 62% soul_shard
soothing_shade
3:29.648 aoe J conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
soothing_shade
3:30.954 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
backdraft
3:32.173 aoe F immolate enemy3 49002.0/50000: 98% mana
2.2/5: 44% soul_shard
3:33.480 aoe L incinerate Fluffy_Pillow 48905.5/50000: 98% mana
2.4/5: 48% soul_shard
3:35.222 aoe I rain_of_fire Fluffy_Pillow 48776.5/50000: 98% mana
3.1/5: 62% soul_shard
3:36.529 aoe J conflagrate Fluffy_Pillow 49430.0/50000: 99% mana
0.5/5: 10% soul_shard
3:37.835 aoe L incinerate Fluffy_Pillow 49583.0/50000: 99% mana
1.0/5: 20% soul_shard
backdraft
3:39.054 aoe K impending_catastrophe Fluffy_Pillow 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
3:40.795 aoe L incinerate Fluffy_Pillow 47872.5/50000: 96% mana
1.5/5: 30% soul_shard
3:42.536 aoe L incinerate Fluffy_Pillow 47743.0/50000: 95% mana
2.0/5: 40% soul_shard
3:44.275 default A cataclysm Fluffy_Pillow 47612.5/50000: 95% mana
2.6/5: 52% soul_shard
3:46.016 aoe H havoc enemy2 47983.0/50000: 96% mana
2.6/5: 52% soul_shard
3:47.321 havoc N conflagrate Fluffy_Pillow 47635.5/50000: 95% mana
3.0/5: 60% soul_shard
3:48.629 havoc Q chaos_bolt Fluffy_Pillow 47789.5/50000: 96% mana
4.0/5: 80% soul_shard
backdraft
3:50.457 havoc Q chaos_bolt Fluffy_Pillow 48703.5/50000: 97% mana
2.4/5: 48% soul_shard
3:53.067 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
3:54.372 havoc R incinerate Fluffy_Pillow 49251.5/50000: 99% mana
0.7/5: 14% soul_shard
3:56.113 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.5/5: 30% soul_shard
3:57.420 aoe E channel_demonfire Fluffy_Pillow 49156.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
4:00.232 aoe I rain_of_fire Fluffy_Pillow 49812.0/50000: 100% mana
3.2/5: 64% soul_shard
backdraft
4:01.537 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft
4:02.758 aoe J conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
0.7/5: 14% soul_shard
4:04.065 aoe L incinerate Fluffy_Pillow 49156.5/50000: 98% mana
1.2/5: 24% soul_shard
backdraft
4:05.283 aoe F immolate enemy3 48765.5/50000: 98% mana
1.7/5: 34% soul_shard
4:06.588 aoe L incinerate Fluffy_Pillow 48668.0/50000: 97% mana
1.7/5: 34% soul_shard
4:08.329 default 9 soul_fire Fluffy_Pillow 48538.5/50000: 97% mana
2.4/5: 48% soul_shard
4:11.807 aoe F immolate Fluffy_Pillow 49002.5/50000: 98% mana
3.8/5: 76% soul_shard
4:13.111 aoe F immolate enemy2 48904.5/50000: 98% mana
4.2/5: 84% soul_shard
4:14.419 aoe I rain_of_fire Fluffy_Pillow 48808.5/50000: 98% mana
4.2/5: 84% soul_shard
4:15.726 aoe J conflagrate Fluffy_Pillow 49462.0/50000: 99% mana
1.4/5: 28% soul_shard
4:17.034 default A cataclysm Fluffy_Pillow 49616.0/50000: 99% mana
2.0/5: 40% soul_shard
backdraft
4:18.775 aoe H havoc enemy2 49502.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft
4:20.081 havoc Q chaos_bolt Fluffy_Pillow 49155.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
4:21.908 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
4:23.648 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
soothing_shade
4:24.958 havoc Q chaos_bolt Fluffy_Pillow 49157.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft, soothing_shade
4:26.787 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
soothing_shade
4:28.529 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.2/5: 24% soul_shard
soothing_shade
4:29.836 havoc P immolate Fluffy_Pillow 49156.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft, soothing_shade
4:31.143 aoe E channel_demonfire Fluffy_Pillow 49060.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft, soothing_shade
4:33.936 aoe F immolate enemy2 49706.5/50000: 99% mana
2.8/5: 56% soul_shard
backdraft, soothing_shade
4:35.242 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.0/5: 60% soul_shard
backdraft
4:36.549 aoe L incinerate Fluffy_Pillow 49905.5/50000: 100% mana
0.1/5: 2% soul_shard
backdraft
4:37.769 aoe F immolate enemy3 49002.5/50000: 98% mana
0.4/5: 8% soul_shard
4:39.075 aoe J conflagrate Fluffy_Pillow 48905.5/50000: 98% mana
0.6/5: 12% soul_shard
4:40.380 aoe L incinerate Fluffy_Pillow 49058.0/50000: 98% mana
1.2/5: 24% soul_shard
backdraft
4:41.599 aoe K impending_catastrophe Fluffy_Pillow 48667.5/50000: 97% mana
1.6/5: 32% soul_shard
4:43.340 aoe J conflagrate Fluffy_Pillow 47538.0/50000: 95% mana
1.9/5: 38% soul_shard
soothing_shade
4:44.857 aoe L incinerate Fluffy_Pillow 47796.5/50000: 96% mana
2.6/5: 52% soul_shard
backdraft, soothing_shade
4:46.077 aoe L incinerate Fluffy_Pillow 47406.5/50000: 95% mana
2.9/5: 58% soul_shard
soothing_shade
4:47.817 aoe I rain_of_fire Fluffy_Pillow 47276.5/50000: 95% mana
3.4/5: 68% soul_shard
soothing_shade
4:49.123 default A cataclysm Fluffy_Pillow 47929.5/50000: 96% mana
0.5/5: 10% soul_shard
soothing_shade
4:50.863 aoe H havoc enemy2 48299.5/50000: 97% mana
0.8/5: 16% soul_shard
soothing_shade
4:52.170 havoc N conflagrate Fluffy_Pillow 47953.0/50000: 96% mana
1.0/5: 20% soul_shard
soothing_shade
4:53.505 havoc Q chaos_bolt Fluffy_Pillow 48120.5/50000: 96% mana
2.2/5: 44% soul_shard
backdraft, soothing_shade
4:55.333 havoc R incinerate Fluffy_Pillow 49034.5/50000: 98% mana
0.3/5: 6% soul_shard
soothing_shade
4:57.075 havoc O soul_fire Fluffy_Pillow 48905.5/50000: 98% mana
0.9/5: 18% soul_shard
5:00.551 havoc P immolate Fluffy_Pillow 49001.5/50000: 98% mana
3.4/5: 68% soul_shard
5:01.857 havoc N conflagrate Fluffy_Pillow 48904.5/50000: 98% mana
3.6/5: 72% soul_shard
5:03.165 aoe E channel_demonfire Fluffy_Pillow 49058.5/50000: 98% mana
4.7/5: 94% soul_shard
backdraft
5:05.890 aoe I rain_of_fire Fluffy_Pillow 49671.0/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
5:07.198 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.2/5: 44% soul_shard
backdraft
5:08.417 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
5:10.158 aoe F immolate enemy3 48872.5/50000: 98% mana
3.0/5: 60% soul_shard
5:11.464 aoe I rain_of_fire Fluffy_Pillow 48775.5/50000: 98% mana
3.0/5: 60% soul_shard
5:12.769 aoe J conflagrate Fluffy_Pillow 49428.0/50000: 99% mana
0.3/5: 6% soul_shard
5:14.078 aoe L incinerate Fluffy_Pillow 49582.5/50000: 99% mana
0.8/5: 16% soul_shard
backdraft
5:15.298 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
5:17.037 aoe L incinerate Fluffy_Pillow 48872.0/50000: 98% mana
1.7/5: 34% soul_shard
5:18.775 aoe J conflagrate Fluffy_Pillow 48741.0/50000: 97% mana
2.0/5: 40% soul_shard
5:20.081 aoe L incinerate Fluffy_Pillow 48894.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
5:21.301 default A cataclysm Fluffy_Pillow 48504.0/50000: 97% mana
3.1/5: 62% soul_shard

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Venthyr_Theotar"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=venthyr
soulbind=336239/ashen_remains:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

destruction : 9255 dps, 4979 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9254.9 9254.9 16.1 / 0.174% 757.5 / 8.2% 20.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
395.6 392.9 Mana 0.00% 38.2 100.0% 100%
Talents

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
destruction 9255
Cataclysm 775 8.4% 9.7 32.55sec 24006 14130 Direct 29.0 6706 13414 8004 19.3%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.65 28.96 0.00 0.00 1.6991 0.0000 231729.33 231729.33 0.00% 14129.84 14129.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 23.36 15 34 6705.77 6141 7261 6706.50 6513 6952 156670 156670 0.00%
crit 19.32% 5.60 0 13 13414.39 12283 14521 13395.08 0 14280 75059 75059 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.70
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1031) 0.0% (11.2%) 12.3 25.18sec 25119 9318

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.26 0.00 183.11 0.00 2.6956 0.1636 0.00 0.00 0.00% 9318.31 9318.31

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.27
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1031 11.2% 0.0 0.00sec 0 0 Direct 549.3 470 942 561 19.2%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 549.32 0.00 0.00 0.0000 0.0000 308054.12 308054.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 443.66 329 563 469.97 263 976 470.31 448 500 208540 208540 0.00%
crit 19.23% 105.65 62 158 942.00 525 1952 941.87 832 1062 99515 99515 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1249 (1705) 13.5% (18.4%) 22.0 13.28sec 23129 11755 Direct 43.8 (87.0) 0 8524 8524 100.0% (60.0%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.00 43.76 0.00 0.00 1.9677 0.0000 372964.28 372964.28 0.00% 11754.59 11754.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 43.76 30 56 8523.76 5861 11548 8523.62 8360 8704 372964 372964 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [P]:22.10
  • if_expr:cast_time<havoc_remains
    Internal Combustion 455 4.9% 43.2 13.21sec 3142 0 Direct 43.2 2630 5247 3144 19.6%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.23 43.23 0.00 0.00 0.0000 0.0000 135845.08 135845.08 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.43% 34.77 23 50 2629.51 1 3715 2631.93 2406 2845 91438 91438 0.00%
crit 19.57% 8.46 2 20 5247.30 47 7428 5251.53 3779 6802 44407 44407 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 806 8.7% 37.0 7.97sec 6514 5212 Direct 56.0 3602 7197 4302 19.5%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.96 55.97 0.00 0.00 1.2497 0.0000 240739.71 240739.71 0.00% 5212.17 5212.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.54% 45.08 29 59 3601.90 2047 5042 3601.89 3397 3822 162369 162369 0.00%
crit 19.46% 10.89 3 21 7197.35 4096 10084 7195.14 5313 9064 78371 78371 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.03
  • if_expr:buff.backdraft.down
    havoc
    [M]:18.92
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1615 17.5% 27.9 10.33sec 17326 13714 Direct 34.9 1532 3088 1833 19.4%
Periodic 345.7 1014 2027 1211 19.5% 95.6%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.86 34.87 345.67 345.67 1.2634 2.4816 482671.41 482671.41 0.00% 540.51 13713.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 28.11 16 39 1531.58 819 2017 1532.54 1358 1694 43054 43054 0.00%
crit 19.39% 6.76 0 18 3087.60 1640 4032 3080.18 0 3691 20855 20855 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.51% 278.28 207 345 1013.83 1 1261 1014.01 997 1035 282150 282150 0.00%
crit 19.49% 67.38 37 106 2027.38 5 2521 2027.59 1913 2145 136613 136613 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:19.50
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:8.45
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 610 6.6% 46.8 5.89sec 3902 2639 Direct 58.1 (58.1) 2630 5277 3143 19.4% (19.4%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.81 58.12 0.00 0.00 1.4784 0.0000 182636.27 182636.27 0.00% 2639.25 2639.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.63% 46.86 26 67 2629.79 1312 3232 2630.70 2422 2797 123247 123247 0.00%
crit 19.37% 11.26 3 24 5276.66 2625 6464 5281.88 4242 6093 59390 59390 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [K]:35.33
    havoc
    [Q]:11.73
  • if_expr:cast_time<havoc_remains
Rain of Fire 897 9.7% 17.1 16.74sec 15653 12584 Periodic 405.5 553 1106 660 19.4% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.10 0.00 0.00 405.53 1.2439 0.0000 267672.35 267672.35 0.00% 12583.91 12583.91
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.61% 326.89 223 458 552.82 507 599 552.82 545 560 180710 180710 0.00%
crit 19.39% 78.64 43 119 1105.85 1013 1198 1105.86 1086 1124 86963 86963 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.19
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.92
Soul Fire 508 5.5% 5.5 49.52sec 27451 7894 Direct 7.5 16999 33678 20136 18.7%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.52 7.53 0.00 0.00 3.4776 0.0000 151572.94 151572.94 0.00% 7894.01 7894.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.26% 6.12 2 9 16999.29 8641 21175 17020.38 14134 20509 104038 104038 0.00%
crit 18.74% 1.41 0 5 33678.15 17269 42333 26184.23 0 42328 47535 47535 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.55
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [N]:1.07
  • if_expr:cast_time<havoc_remains
Summon Infernal 82 0.9% 2.0 180.65sec 12144 10501 Direct 6.0 3348 6696 4047 20.9%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24288.71 24288.71 0.00% 10500.96 10500.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.09% 4.75 1 6 3348.13 3348 3348 3348.13 3348 3348 15889 15889 0.00%
crit 20.91% 1.25 0 5 6696.27 6696 6696 5099.88 0 6696 8400 8400 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [L]:2.00
pet - infernal 3504 / 712
Immolation 3239 7.0% 39.0 5.50sec 4982 0 Direct 117.0 1395 2790 1661 19.1%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194316.83 194316.83 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.95% 94.71 81 105 1395.06 1395 1395 1395.06 1395 1395 132126 132126 0.00%
crit 19.05% 22.29 12 36 2790.11 2790 2790 2790.11 2790 2790 62190 62190 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.6% 41.0 5.25sec 388 270 Direct 41.0 326 651 388 19.1%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15900.49 22712.26 29.99% 269.94 269.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.87% 33.16 24 41 325.55 326 326 325.55 326 326 10795 15419 29.99%
crit 19.13% 7.84 0 17 651.10 651 651 650.06 0 651 5106 7293 29.94%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.6% 93.0 3.22sec 1652 1135 Direct 92.3 1395 2790 1664 19.3%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.02 92.30 0.00 0.00 1.4558 0.0000 153641.45 153641.45 0.00% 1134.54 1134.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 74.47 55 99 1395.06 1395 1395 1395.06 1395 1395 103888 103888 0.00%
crit 19.32% 17.83 7 31 2790.11 2790 2790 2790.11 2790 2790 49753 49753 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.47
Simple Action Stats Execute Interval
destruction
Havoc 9.6 32.38sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.58 0.00 0.00 0.00 1.2439 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.58
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 37.0 0.0 7.9sec 7.9sec 4.1sec 50.82% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 24.5s
  • trigger_min/max:2.1s / 24.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:50.82%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.56% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.56%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:destruction_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 186.9s
  • trigger_min/max:180.0s / 186.9s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:destruction_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 186.9s
  • trigger_min/max:180.0s / 186.9s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 12.95% 10.19% 15.57% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
destruction
soul_fire Soul Shard 6.53 7.15 7.57% 1.10 0.43 5.73%
immolate Soul Shard 345.69 33.22 35.15% 0.10 1.35 3.90%
incinerate Soul Shard 46.82 11.69 12.37% 0.25 0.00 0.03%
conflagrate Soul Shard 36.95 27.96 29.58% 0.76 0.00 0.00%
mana_regen Mana 655.11 117516.49 100.00% 179.38 31727.98 21.26%
immolate_crits Soul Shard 33.51 3.23 3.41% 0.10 0.13 3.77%
incinerate_crits Soul Shard 11.28 1.13 1.19% 0.10 0.00 0.01%
infernal Soul Shard 120.00 10.14 10.73% 0.08 1.86 15.48%
pet - imp
energy_regen Energy 360.02 3550.34 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 392.88 395.61 31741.0 49184.5 47635.0 50000.0
Soul Shard 4.0 0.32 0.32 3.8 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
destruction
cataclysm Mana 9.7 4830.7 500.0 500.4 48.0
channel_demonfire Mana 12.3 9204.8 750.0 750.6 33.5
chaos_bolt Soul Shard 22.0 44.0 2.0 2.0 11575.3
conflagrate Mana 37.0 18475.0 500.0 499.9 13.0
havoc Mana 9.6 9578.8 1000.0 999.8 0.0
immolate Mana 27.9 20891.2 750.0 749.9 23.1
incinerate Mana 46.8 46823.7 1000.0 1000.4 3.9
rain_of_fire Soul Shard 17.1 51.3 3.0 3.0 5217.4
soul_fire Mana 6.5 6530.4 1000.0 1182.7 23.2
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.1
pet - imp
firebolt Energy 93.0 3720.9 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
destruction Fight Length
Count 625
Mean 299.05
Minimum 240.24
Maximum 359.94
Spread ( max - min ) 119.70
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
destruction Damage Per Second
Count 625
Mean 9254.95
Minimum 8817.48
Maximum 9837.47
Spread ( max - min ) 1019.99
Range [ ( max - min ) / 2 * 100% ] 5.51%
Standard Deviation 205.1697
5th Percentile 8958.12
95th Percentile 9620.38
( 95th Percentile - 5th Percentile ) 662.26
Mean Distribution
Standard Deviation 8.2068
95.00% Confidence Interval ( 9238.86 - 9271.03 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1888
0.1 Scale Factor Error with Delta=300 360
0.05 Scale Factor Error with Delta=300 1438
0.01 Scale Factor Error with Delta=300 35935
Priority Target DPS
destruction Priority Target Damage Per Second
Count 625
Mean 4979.42
Minimum 4633.58
Maximum 5361.50
Spread ( max - min ) 727.92
Range [ ( max - min ) / 2 * 100% ] 7.31%
Standard Deviation 120.8308
5th Percentile 4807.48
95th Percentile 5188.20
( 95th Percentile - 5th Percentile ) 380.72
Mean Distribution
Standard Deviation 4.8332
95.00% Confidence Interval ( 4969.95 - 4988.89 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2263
0.1 Scale Factor Error with Delta=300 125
0.05 Scale Factor Error with Delta=300 499
0.01 Scale Factor Error with Delta=300 12464
DPS(e)
destruction Damage Per Second (Effective)
Count 625
Mean 9254.95
Minimum 8817.48
Maximum 9837.47
Spread ( max - min ) 1019.99
Range [ ( max - min ) / 2 * 100% ] 5.51%
Damage
destruction Damage
Count 625
Mean 2398174.20
Minimum 1941232.92
Maximum 2898641.51
Spread ( max - min ) 957408.59
Range [ ( max - min ) / 2 * 100% ] 19.96%
DTPS
destruction Damage Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
destruction Healing Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
destruction Healing Per Second (Effective)
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
destruction Heal
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
destruction Healing Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
destruction Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
destructionTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
destruction Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.55 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.70 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.19 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.27 channel_demonfire,if=dot.immolate.remains>cast_time
F 19.50 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.58 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.92 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.03 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
K 35.33 incinerate
actions.cds
# count action,conditions
L 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
M 18.92 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
N 1.07 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
O 8.45 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
P 22.10 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
Q 11.73 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AELHPMPMOPMPMDEFFFDKJKKDJKAKJEHPPQMNFFIFJIEKJKAKKHMPPOMPEKFFFJKKI9AHMPMPQQOEFIJFKJKKIKJAHQPQMOP9EJFIKJFKKKAHMPPQMOEIKJKFKLKDJ9AEHPMPMOPDKKFJEFFIKJAHPQQMPOM9EFIJKKFKIAHQMPQMPOEFJKFKIJKKK9AEHPMPMOPMKKFIFEFJ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.740 aoe E channel_demonfire Fluffy_Pillow 49370.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:04.056 cds L summon_infernal Fluffy_Pillow 49778.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust
0:05.063 aoe H havoc enemy2 49281.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust
0:06.071 havoc P chaos_bolt Fluffy_Pillow 48785.5/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust
0:08.079 havoc M conflagrate Fluffy_Pillow 49789.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:09.085 havoc P chaos_bolt Fluffy_Pillow 49792.5/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:10.492 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:11.498 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.9/5: 78% soul_shard
bloodlust, backdraft
0:12.504 havoc P chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:13.910 havoc M conflagrate Fluffy_Pillow 49955.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust
0:14.917 havoc P chaos_bolt Fluffy_Pillow 49958.5/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:16.325 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:17.330 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.1/5: 82% soul_shard
bloodlust, backdraft
0:18.336 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
bloodlust, backdraft
0:20.605 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
bloodlust, backdraft
0:21.612 aoe F immolate enemy2 49252.5/50000: 99% mana
2.6/5: 52% soul_shard
bloodlust, backdraft
0:22.619 aoe F immolate enemy3 49006.0/50000: 98% mana
2.9/5: 58% soul_shard
bloodlust, backdraft
0:23.627 aoe D rain_of_fire Fluffy_Pillow 48760.0/50000: 98% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:24.634 aoe K incinerate Fluffy_Pillow 49263.5/50000: 99% mana
0.5/5: 10% soul_shard
bloodlust, backdraft
0:25.574 aoe J conflagrate Fluffy_Pillow 48733.5/50000: 97% mana
0.9/5: 18% soul_shard
bloodlust
0:26.581 aoe K incinerate Fluffy_Pillow 48737.0/50000: 97% mana
1.8/5: 36% soul_shard
bloodlust, backdraft
0:27.521 aoe K incinerate Fluffy_Pillow 48207.0/50000: 96% mana
2.3/5: 46% soul_shard
bloodlust
0:28.863 aoe D rain_of_fire Fluffy_Pillow 47878.0/50000: 96% mana
3.1/5: 62% soul_shard
bloodlust
0:29.869 aoe J conflagrate Fluffy_Pillow 48381.0/50000: 97% mana
0.5/5: 10% soul_shard
bloodlust
0:30.877 aoe K incinerate Fluffy_Pillow 48385.0/50000: 97% mana
1.4/5: 28% soul_shard
bloodlust, backdraft
0:31.816 default A cataclysm Fluffy_Pillow 47854.5/50000: 96% mana
2.0/5: 40% soul_shard
bloodlust
0:33.155 aoe K incinerate Fluffy_Pillow 48024.0/50000: 96% mana
2.4/5: 48% soul_shard
bloodlust
0:34.496 aoe J conflagrate Fluffy_Pillow 47694.5/50000: 95% mana
3.0/5: 60% soul_shard
bloodlust
0:35.699 aoe E channel_demonfire Fluffy_Pillow 47796.0/50000: 96% mana
3.7/5: 74% soul_shard
bloodlust, backdraft
0:37.955 aoe H havoc enemy2 48174.0/50000: 96% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:38.962 havoc P chaos_bolt Fluffy_Pillow 47677.5/50000: 95% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:40.368 havoc P chaos_bolt Fluffy_Pillow 48380.5/50000: 97% mana
2.5/5: 50% soul_shard
bloodlust
0:42.377 havoc Q incinerate Fluffy_Pillow 49385.0/50000: 99% mana
0.9/5: 18% soul_shard
0:44.117 havoc M conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
0:45.424 havoc N soul_fire Fluffy_Pillow 49155.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
0:48.900 aoe F immolate enemy2 49001.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:50.207 aoe F immolate Fluffy_Pillow 48905.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:51.513 aoe I rain_of_fire Fluffy_Pillow 48808.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:52.820 aoe F immolate enemy3 49461.5/50000: 99% mana
2.3/5: 46% soul_shard
backdraft
0:54.125 aoe J conflagrate Fluffy_Pillow 49251.5/50000: 99% mana
2.4/5: 48% soul_shard
0:55.430 aoe I rain_of_fire Fluffy_Pillow 49404.0/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
0:56.737 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
backdraft
0:59.564 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft
1:00.782 aoe J conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.1/5: 22% soul_shard
1:02.088 aoe K incinerate Fluffy_Pillow 49154.5/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
1:03.308 default A cataclysm Fluffy_Pillow 48764.5/50000: 98% mana
2.1/5: 42% soul_shard
1:05.048 aoe K incinerate Fluffy_Pillow 49134.5/50000: 98% mana
2.2/5: 44% soul_shard
1:06.788 aoe K incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.7/5: 54% soul_shard
1:08.527 aoe H havoc enemy2 48871.5/50000: 98% mana
3.1/5: 62% soul_shard
1:09.833 havoc M conflagrate Fluffy_Pillow 48524.5/50000: 97% mana
3.2/5: 64% soul_shard
1:11.139 havoc P chaos_bolt Fluffy_Pillow 48677.5/50000: 97% mana
4.5/5: 90% soul_shard
backdraft
1:12.967 havoc P chaos_bolt Fluffy_Pillow 49591.5/50000: 99% mana
2.7/5: 54% soul_shard
1:15.576 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
1:16.883 havoc M conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
1.3/5: 26% soul_shard
1:18.189 havoc P chaos_bolt Fluffy_Pillow 49405.5/50000: 99% mana
2.4/5: 48% soul_shard
backdraft
1:20.016 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
1:22.808 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
1:24.548 aoe F immolate enemy3 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
1:25.854 aoe F immolate Fluffy_Pillow 48905.0/50000: 98% mana
1.5/5: 30% soul_shard
1:27.159 aoe F immolate enemy2 48807.5/50000: 98% mana
1.9/5: 38% soul_shard
1:28.465 aoe J conflagrate Fluffy_Pillow 48710.5/50000: 97% mana
1.9/5: 38% soul_shard
1:29.771 aoe K incinerate Fluffy_Pillow 48863.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
1:30.990 aoe K incinerate Fluffy_Pillow 48473.0/50000: 97% mana
2.9/5: 58% soul_shard
1:32.731 aoe I rain_of_fire Fluffy_Pillow 48343.5/50000: 97% mana
3.5/5: 70% soul_shard
1:34.039 default 9 soul_fire Fluffy_Pillow 48997.5/50000: 98% mana
0.6/5: 12% soul_shard
1:37.517 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
2.2/5: 44% soul_shard
1:39.259 aoe H havoc enemy2 49373.5/50000: 99% mana
2.3/5: 46% soul_shard
1:40.566 havoc M conflagrate Fluffy_Pillow 49027.0/50000: 98% mana
2.5/5: 50% soul_shard
1:41.873 havoc P chaos_bolt Fluffy_Pillow 49180.5/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
1:43.700 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
1:45.006 havoc P chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.1/5: 62% soul_shard
backdraft
1:46.834 havoc Q incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
1:48.574 havoc Q incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.9/5: 38% soul_shard
1:50.314 havoc O immolate Fluffy_Pillow 48872.0/50000: 98% mana
2.6/5: 52% soul_shard
1:51.620 aoe E channel_demonfire Fluffy_Pillow 48775.0/50000: 98% mana
2.7/5: 54% soul_shard
1:54.514 aoe F immolate enemy2 49472.0/50000: 99% mana
3.1/5: 62% soul_shard
1:55.820 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.3/5: 66% soul_shard
1:57.127 aoe J conflagrate Fluffy_Pillow 49905.5/50000: 100% mana
0.3/5: 6% soul_shard
1:58.435 aoe F immolate enemy3 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
backdraft
1:59.742 aoe K incinerate Fluffy_Pillow 49252.5/50000: 99% mana
1.1/5: 22% soul_shard
backdraft
2:00.961 aoe J conflagrate Fluffy_Pillow 48862.0/50000: 98% mana
1.6/5: 32% soul_shard
2:02.268 aoe K incinerate Fluffy_Pillow 49015.5/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
2:03.487 aoe K incinerate Fluffy_Pillow 48625.0/50000: 97% mana
2.5/5: 50% soul_shard
2:05.226 aoe I rain_of_fire Fluffy_Pillow 48494.5/50000: 97% mana
3.1/5: 62% soul_shard
2:06.533 aoe K incinerate Fluffy_Pillow 49148.0/50000: 98% mana
0.3/5: 6% soul_shard
2:08.274 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.6/5: 12% soul_shard
2:09.580 default A cataclysm Fluffy_Pillow 49155.5/50000: 98% mana
1.3/5: 26% soul_shard
backdraft
2:11.321 aoe H havoc enemy2 49502.5/50000: 99% mana
1.5/5: 30% soul_shard
backdraft
2:12.629 havoc Q incinerate Fluffy_Pillow 49156.5/50000: 98% mana
1.6/5: 32% soul_shard
backdraft
2:13.849 havoc P chaos_bolt Fluffy_Pillow 48766.5/50000: 98% mana
2.1/5: 42% soul_shard
2:16.458 havoc Q incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
2:18.198 havoc M conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
2:19.504 havoc O immolate Fluffy_Pillow 49155.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:20.811 havoc P chaos_bolt Fluffy_Pillow 49058.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
2:22.638 default 9 soul_fire Fluffy_Pillow 49972.0/50000: 100% mana
0.7/5: 14% soul_shard
2:26.115 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
2.3/5: 46% soul_shard
2:29.005 aoe J conflagrate Fluffy_Pillow 49697.0/50000: 99% mana
2.6/5: 52% soul_shard
2:30.313 aoe F immolate enemy3 49851.0/50000: 100% mana
3.3/5: 66% soul_shard
backdraft
2:31.618 aoe I rain_of_fire Fluffy_Pillow 49251.5/50000: 99% mana
3.4/5: 68% soul_shard
backdraft
2:32.923 aoe K incinerate Fluffy_Pillow 49904.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
2:34.143 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.9/5: 18% soul_shard
2:35.448 aoe F immolate enemy2 49155.0/50000: 98% mana
1.6/5: 32% soul_shard
backdraft
2:36.754 aoe K incinerate Fluffy_Pillow 49058.0/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
2:37.973 aoe K incinerate Fluffy_Pillow 48667.5/50000: 97% mana
2.1/5: 42% soul_shard
2:39.713 aoe K incinerate Fluffy_Pillow 48537.5/50000: 97% mana
2.4/5: 48% soul_shard
2:41.453 default A cataclysm Fluffy_Pillow 48407.5/50000: 97% mana
2.8/5: 56% soul_shard
2:43.193 aoe H havoc enemy2 48777.5/50000: 98% mana
3.1/5: 62% soul_shard
2:44.500 havoc M conflagrate Fluffy_Pillow 48431.0/50000: 97% mana
3.2/5: 64% soul_shard
2:45.806 havoc P chaos_bolt Fluffy_Pillow 48584.0/50000: 97% mana
4.4/5: 88% soul_shard
backdraft
2:47.630 havoc P chaos_bolt Fluffy_Pillow 49496.0/50000: 99% mana
2.5/5: 50% soul_shard
2:50.239 havoc Q incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
2:51.979 havoc M conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
2:53.284 havoc O immolate Fluffy_Pillow 49154.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
2:54.591 aoe E channel_demonfire Fluffy_Pillow 49058.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
2:57.394 aoe I rain_of_fire Fluffy_Pillow 49709.5/50000: 99% mana
3.2/5: 64% soul_shard
backdraft
2:58.700 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
backdraft
2:59.919 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.7/5: 14% soul_shard
3:01.226 aoe K incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
3:02.446 aoe F immolate enemy3 48765.5/50000: 98% mana
1.8/5: 36% soul_shard
3:03.753 aoe K incinerate Fluffy_Pillow 48669.0/50000: 97% mana
2.0/5: 40% soul_shard
3:05.493 cds L summon_infernal Fluffy_Pillow 48539.0/50000: 97% mana
2.4/5: 48% soul_shard
3:06.799 aoe K incinerate Fluffy_Pillow 48192.0/50000: 96% mana
2.8/5: 56% soul_shard
3:08.539 aoe D rain_of_fire Fluffy_Pillow 48062.0/50000: 96% mana
3.5/5: 70% soul_shard
3:09.845 aoe J conflagrate Fluffy_Pillow 48715.0/50000: 97% mana
0.9/5: 18% soul_shard
3:11.151 default 9 soul_fire Fluffy_Pillow 48868.0/50000: 98% mana
1.8/5: 36% soul_shard
backdraft
3:14.629 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
4.2/5: 84% soul_shard
backdraft
3:16.368 aoe E channel_demonfire Fluffy_Pillow 49372.0/50000: 99% mana
4.6/5: 92% soul_shard
backdraft
3:19.189 aoe H havoc enemy2 50000.0/50000: 100% mana
5.0/5: 100% soul_shard
backdraft
3:20.495 havoc P chaos_bolt Fluffy_Pillow 49653.0/50000: 99% mana
5.0/5: 100% soul_shard
3:23.104 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:24.408 havoc P chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:26.236 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:27.543 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:28.852 havoc P chaos_bolt Fluffy_Pillow 49253.5/50000: 99% mana
4.8/5: 96% soul_shard
backdraft
3:30.681 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:31.988 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
3:33.728 aoe K incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
3:35.468 aoe F immolate enemy3 48872.0/50000: 98% mana
2.1/5: 42% soul_shard
3:36.774 aoe J conflagrate Fluffy_Pillow 48775.0/50000: 98% mana
2.4/5: 48% soul_shard
3:38.080 aoe E channel_demonfire Fluffy_Pillow 48928.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
3:40.938 aoe F immolate Fluffy_Pillow 49607.0/50000: 99% mana
3.3/5: 66% soul_shard
backdraft
3:42.244 aoe F immolate enemy2 49252.0/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
3:43.550 aoe I rain_of_fire Fluffy_Pillow 49155.0/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
3:44.856 aoe K incinerate Fluffy_Pillow 49808.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft
3:46.077 aoe J conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.0/5: 20% soul_shard
3:47.384 default A cataclysm Fluffy_Pillow 49156.5/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
3:49.126 aoe H havoc enemy2 49503.0/50000: 99% mana
1.9/5: 38% soul_shard
backdraft
3:50.495 havoc P chaos_bolt Fluffy_Pillow 49187.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
3:52.323 havoc Q incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
3:54.062 havoc Q incinerate Fluffy_Pillow 49001.5/50000: 98% mana
0.9/5: 18% soul_shard
3:55.803 havoc M conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
1.5/5: 30% soul_shard
3:57.110 havoc P chaos_bolt Fluffy_Pillow 49025.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
3:58.938 havoc O immolate Fluffy_Pillow 49939.5/50000: 100% mana
0.9/5: 18% soul_shard
4:00.246 havoc M conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
1.1/5: 22% soul_shard
4:01.681 default 9 soul_fire Fluffy_Pillow 49470.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft
4:05.159 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
4:07.949 aoe F immolate enemy3 49647.5/50000: 99% mana
4.1/5: 82% soul_shard
backdraft
4:09.255 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
4.2/5: 84% soul_shard
backdraft
4:10.561 aoe J conflagrate Fluffy_Pillow 49905.0/50000: 100% mana
1.4/5: 28% soul_shard
4:11.869 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.0/5: 40% soul_shard
backdraft
4:13.088 aoe K incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.4/5: 48% soul_shard
4:14.830 aoe F immolate enemy2 48873.0/50000: 98% mana
2.8/5: 56% soul_shard
4:16.137 aoe K incinerate Fluffy_Pillow 48776.5/50000: 98% mana
2.9/5: 58% soul_shard
4:17.876 aoe I rain_of_fire Fluffy_Pillow 48646.0/50000: 97% mana
3.4/5: 68% soul_shard
4:19.183 default A cataclysm Fluffy_Pillow 49299.5/50000: 99% mana
0.5/5: 10% soul_shard
4:20.923 aoe H havoc enemy2 49502.0/50000: 99% mana
0.7/5: 14% soul_shard
4:22.229 havoc Q incinerate Fluffy_Pillow 49155.0/50000: 98% mana
0.8/5: 16% soul_shard
4:23.968 havoc M conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.4/5: 28% soul_shard
4:25.274 havoc P chaos_bolt Fluffy_Pillow 49154.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
4:27.101 havoc Q incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
4:28.841 havoc M conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
4:30.149 havoc P chaos_bolt Fluffy_Pillow 49156.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
4:31.975 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
4:33.281 aoe E channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
1.1/5: 22% soul_shard
4:36.180 aoe F immolate enemy2 49951.5/50000: 100% mana
1.6/5: 32% soul_shard
4:37.487 aoe J conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
1.7/5: 34% soul_shard
4:38.794 aoe K incinerate Fluffy_Pillow 49406.0/50000: 99% mana
2.3/5: 46% soul_shard
backdraft
4:40.015 aoe F immolate enemy3 49003.0/50000: 98% mana
2.6/5: 52% soul_shard
4:41.323 aoe K incinerate Fluffy_Pillow 48907.0/50000: 98% mana
2.8/5: 56% soul_shard
4:43.063 aoe I rain_of_fire Fluffy_Pillow 48777.0/50000: 98% mana
3.2/5: 64% soul_shard
4:44.367 aoe J conflagrate Fluffy_Pillow 49429.0/50000: 99% mana
0.3/5: 6% soul_shard
4:45.672 aoe K incinerate Fluffy_Pillow 49581.5/50000: 99% mana
1.0/5: 20% soul_shard
backdraft
4:46.891 aoe K incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
4:48.631 aoe K incinerate Fluffy_Pillow 48872.0/50000: 98% mana
1.7/5: 34% soul_shard
4:50.374 default 9 soul_fire Fluffy_Pillow 48743.5/50000: 97% mana
2.1/5: 42% soul_shard
4:53.852 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
3.6/5: 72% soul_shard
4:55.594 aoe E channel_demonfire Fluffy_Pillow 49373.5/50000: 99% mana
3.8/5: 76% soul_shard
4:58.399 aoe H havoc enemy2 50000.0/50000: 100% mana
4.1/5: 82% soul_shard
4:59.704 havoc P chaos_bolt Fluffy_Pillow 49652.5/50000: 99% mana
4.2/5: 84% soul_shard
5:02.314 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
5:03.619 havoc P chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.8/5: 76% soul_shard
backdraft
5:05.447 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
5:06.756 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.2/5: 64% soul_shard
backdraft
5:08.063 havoc P chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
3.3/5: 66% soul_shard
backdraft
5:09.890 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
5:11.196 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
backdraft
5:12.412 aoe K incinerate Fluffy_Pillow 49000.5/50000: 98% mana
2.9/5: 58% soul_shard
5:14.153 aoe F immolate enemy3 48871.0/50000: 98% mana
3.4/5: 68% soul_shard
5:15.461 aoe I rain_of_fire Fluffy_Pillow 48775.0/50000: 98% mana
3.5/5: 70% soul_shard
5:16.766 aoe F immolate enemy2 49427.5/50000: 99% mana
0.8/5: 16% soul_shard
5:18.072 aoe E channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
0.9/5: 18% soul_shard
5:20.900 aoe F immolate Fluffy_Pillow 49916.0/50000: 100% mana
1.2/5: 24% soul_shard
5:22.206 aoe J conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
1.6/5: 32% soul_shard

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="destruction"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Simulation & Raid Information

Iterations: 641
Threads: 16
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 299.1 )

Performance:

Total Events Processed: 16850515
Max Event Queue: 349
Sim Seconds: 191692
CPU Seconds: 28.8281
Physical Seconds: 2.0680
Speed Up: 6649

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Kyrian_Forgelite Kyrian_Forgelite cataclysm 152108 233075 779 5.83 6705 13418 9.7 29.1 19.6% 0.0% 0.0% 0.0% 32.42sec 233075 299.05sec
Kyrian_Forgelite Kyrian_Forgelite channel_demonfire 196447 0 0 0.00 0 0 11.9 0.0 0.0% 0.0% 0.0% 0.0% 25.79sec 0 299.05sec
Kyrian_Forgelite Kyrian_Forgelite channel_demonfire_tick 196448 298578 998 107.02 469 936 0.0 533.4 19.4% 0.0% 0.0% 0.0% 0.00sec 298578 299.05sec
Kyrian_Forgelite Kyrian_Forgelite chaos_bolt 116858 337153 1127 7.49 0 9032 18.8 37.3 100.0% 0.0% 0.0% 0.0% 15.97sec 337153 299.05sec
Kyrian_Forgelite Kyrian_Forgelite internal_combustion 266134 110989 371 7.29 2559 5136 36.3 36.3 19.2% 0.0% 0.0% 0.0% 15.96sec 110989 299.05sec
Kyrian_Forgelite Kyrian_Forgelite conflagrate 17962 235674 788 10.97 3621 7240 36.7 54.7 19.0% 0.0% 0.0% 0.0% 7.96sec 235674 299.05sec
Kyrian_Forgelite Kyrian_Forgelite havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.29sec 0 299.05sec
Kyrian_Forgelite Kyrian_Forgelite immolate 348 56954 190 6.32 1517 3029 25.3 31.5 19.3% 0.0% 0.0% 0.0% 11.63sec 474980 299.05sec
Kyrian_Forgelite Kyrian_Forgelite immolate ticks -348 418025 1393 69.16 1015 2030 25.3 345.8 19.1% 0.0% 0.0% 0.0% 11.63sec 474980 299.05sec
Kyrian_Forgelite Kyrian_Forgelite incinerate 29722 166048 555 10.03 2782 5558 39.3 50.0 19.4% 0.0% 0.0% 0.0% 6.98sec 166048 299.05sec
Kyrian_Forgelite Kyrian_Forgelite rain_of_fire ticks -5740 288522 962 0.00 553 1106 18.4 0.0 19.3% 0.0% 0.0% 0.0% 15.48sec 288522 299.05sec
Kyrian_Forgelite Kyrian_Forgelite scouring_tithe 312321 33291 111 3.76 1482 2966 13.4 18.7 19.8% 0.0% 0.0% 0.0% 22.61sec 98945 299.05sec
Kyrian_Forgelite Kyrian_Forgelite scouring_tithe ticks -312321 65655 219 26.63 413 826 13.4 133.2 19.3% 0.0% 0.0% 0.0% 22.61sec 98945 299.05sec
Kyrian_Forgelite Kyrian_Forgelite soul_fire 6353 142390 476 1.47 16234 32525 5.5 7.3 19.4% 0.0% 0.0% 0.0% 49.46sec 142390 299.05sec
Kyrian_Forgelite Kyrian_Forgelite summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.05sec
Kyrian_Forgelite Kyrian_Forgelite summon_infernal 1122 24032 80 1.20 3348 6696 2.0 6.0 19.6% 0.0% 0.0% 0.0% 180.56sec 24032 299.05sec
Kyrian_Forgelite Kyrian_Forgelite_infernal immolation 20153 194806 3247 117.00 1395 2790 39.0 117.0 19.4% 0.0% 0.0% 0.0% 5.49sec 194806 60.00sec
Kyrian_Forgelite Kyrian_Forgelite_infernal melee 0 15905 265 41.00 326 651 41.0 41.0 19.2% 0.0% 0.0% 0.0% 5.25sec 22718 60.00sec
Kyrian_Forgelite Kyrian_Forgelite_imp firebolt 3110 153376 513 18.52 1395 2790 93.0 92.3 19.1% 0.0% 0.0% 0.0% 3.22sec 153376 299.05sec
Kyrian_Forgelite Kyrian_Forgelite_bron anima_cannon 332525 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 8.00sec 0 30.00sec
Kyrian_Forgelite Kyrian_Forgelite_bron goliath_support 332526 0 0 0.00 0 0 7.0 0.0 0.0% 0.0% 0.0% 0.0% 4.00sec 0 30.00sec
Kyrian_Forgelite Kyrian_Forgelite_bron melee 0 1844 61 18.00 172 343 9.0 9.0 19.3% 0.0% 0.0% 0.0% 2.88sec 2634 30.00sec
Kyrian_Forgelite Kyrian_Forgelite_bron smash 341163 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 8.17sec 0 30.00sec
Kyrian_Pelagos Kyrian_Pelagos cataclysm 152108 234132 783 5.83 6775 13543 9.7 29.1 18.9% 0.0% 0.0% 0.0% 32.37sec 234132 299.05sec
Kyrian_Pelagos Kyrian_Pelagos channel_demonfire 196447 0 0 0.00 0 0 11.9 0.0 0.0% 0.0% 0.0% 0.0% 25.91sec 0 299.05sec
Kyrian_Pelagos Kyrian_Pelagos channel_demonfire_tick 196448 309714 1036 106.97 487 977 0.0 533.2 19.3% 0.0% 0.0% 0.0% 0.00sec 309714 299.05sec
Kyrian_Pelagos Kyrian_Pelagos chaos_bolt 116858 352883 1180 7.50 0 9443 18.8 37.4 100.0% 0.0% 0.0% 0.0% 15.30sec 352883 299.05sec
Kyrian_Pelagos Kyrian_Pelagos internal_combustion 266134 116037 388 7.29 2670 5397 36.3 36.3 19.2% 0.0% 0.0% 0.0% 15.37sec 116037 299.05sec
Kyrian_Pelagos Kyrian_Pelagos conflagrate 17962 246205 823 11.00 3759 7526 36.8 54.8 19.4% 0.0% 0.0% 0.0% 7.97sec 246205 299.05sec
Kyrian_Pelagos Kyrian_Pelagos havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.21sec 0 299.05sec
Kyrian_Pelagos Kyrian_Pelagos immolate 348 59533 199 6.31 1591 3187 25.3 31.5 18.8% 0.0% 0.0% 0.0% 11.37sec 492126 299.05sec
Kyrian_Pelagos Kyrian_Pelagos immolate ticks -348 432593 1442 69.09 1051 2100 25.3 345.5 19.2% 0.0% 0.0% 0.0% 11.37sec 492126 299.05sec
Kyrian_Pelagos Kyrian_Pelagos incinerate 29722 172403 576 10.01 2887 5778 39.3 49.9 19.6% 0.0% 0.0% 0.0% 7.15sec 172403 299.05sec
Kyrian_Pelagos Kyrian_Pelagos rain_of_fire ticks -5740 298623 995 0.00 573 1146 18.4 0.0 19.3% 0.0% 0.0% 0.0% 15.80sec 298623 299.05sec
Kyrian_Pelagos Kyrian_Pelagos scouring_tithe 312321 32954 110 3.75 1484 2951 13.3 18.7 19.0% 0.0% 0.0% 0.0% 22.76sec 98366 299.05sec
Kyrian_Pelagos Kyrian_Pelagos scouring_tithe ticks -312321 65412 218 26.54 413 826 13.3 132.7 19.3% 0.0% 0.0% 0.0% 22.76sec 98366 299.05sec
Kyrian_Pelagos Kyrian_Pelagos soul_fire 6353 144856 484 1.48 16442 32839 5.5 7.4 19.6% 0.0% 0.0% 0.0% 49.50sec 144856 299.05sec
Kyrian_Pelagos Kyrian_Pelagos summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.05sec
Kyrian_Pelagos Kyrian_Pelagos summon_infernal 1122 24112 81 1.20 3348 6696 2.0 6.0 20.0% 0.0% 0.0% 0.0% 180.54sec 24112 299.05sec
Kyrian_Pelagos Kyrian_Pelagos_infernal immolation 20153 213237 3554 117.00 1530 3055 39.0 117.0 19.2% 0.0% 0.0% 0.0% 5.49sec 213237 60.00sec
Kyrian_Pelagos Kyrian_Pelagos_infernal melee 0 15908 265 41.00 326 651 41.0 41.0 19.2% 0.0% 0.0% 0.0% 5.25sec 22723 60.00sec
Kyrian_Pelagos Kyrian_Pelagos_imp firebolt 3110 153318 513 18.52 1395 2790 93.0 92.3 19.1% 0.0% 0.0% 0.0% 3.22sec 153318 299.05sec
Necrolord_Emeni Necrolord_Emeni cataclysm 152108 234841 785 5.81 6808 13631 9.7 29.0 19.0% 0.0% 0.0% 0.0% 32.43sec 234841 299.05sec
Necrolord_Emeni Necrolord_Emeni channel_demonfire 196447 0 0 0.00 0 0 12.1 0.0 0.0% 0.0% 0.0% 0.0% 25.87sec 0 299.05sec
Necrolord_Emeni Necrolord_Emeni channel_demonfire_tick 196448 311408 1041 108.33 484 965 0.0 539.9 19.4% 0.0% 0.0% 0.0% 0.00sec 311408 299.05sec
Necrolord_Emeni Necrolord_Emeni chaos_bolt 116858 357945 1197 7.59 0 9461 19.0 37.8 100.0% 0.0% 0.0% 0.0% 15.25sec 357945 299.05sec
Necrolord_Emeni Necrolord_Emeni internal_combustion 266134 116959 391 7.43 2652 5353 37.0 37.0 18.8% 0.0% 0.0% 0.0% 15.22sec 116959 299.05sec
Necrolord_Emeni Necrolord_Emeni conflagrate 17962 246039 823 11.04 3741 7536 36.7 55.0 19.2% 0.0% 0.0% 0.0% 7.98sec 246039 299.05sec
Necrolord_Emeni Necrolord_Emeni decimating_bolt 325289 0 0 0.00 0 0 6.4 0.0 0.0% 0.0% 0.0% 0.0% 49.36sec 0 299.05sec
Necrolord_Emeni Necrolord_Emeni decimating_bolt_tick_t 327059 55986 187 7.83 1210 2417 0.0 39.0 18.5% 0.0% 0.0% 0.0% 0.00sec 55986 299.05sec
Necrolord_Emeni Necrolord_Emeni havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.19sec 0 299.05sec
Necrolord_Emeni Necrolord_Emeni immolate 348 59803 200 6.48 1546 3084 25.9 32.3 19.9% 0.0% 0.0% 0.0% 11.05sec 491128 299.05sec
Necrolord_Emeni Necrolord_Emeni immolate ticks -348 431325 1438 69.52 1041 2084 25.9 347.6 19.1% 0.0% 0.0% 0.0% 11.05sec 491128 299.05sec
Necrolord_Emeni Necrolord_Emeni incinerate 29722 280124 937 10.86 4336 8753 43.3 54.1 19.0% 0.0% 0.0% 0.0% 6.42sec 280124 299.05sec
Necrolord_Emeni Necrolord_Emeni rain_of_fire ticks -5740 295862 986 0.00 564 1130 18.5 0.0 19.3% 0.0% 0.0% 0.0% 15.60sec 295862 299.05sec
Necrolord_Emeni Necrolord_Emeni soul_fire 6353 147626 494 1.57 15962 31357 5.5 7.8 18.9% 0.0% 0.0% 0.0% 49.50sec 147626 299.05sec
Necrolord_Emeni Necrolord_Emeni summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.05sec
Necrolord_Emeni Necrolord_Emeni summon_infernal 1122 23983 80 1.20 3348 6696 2.0 6.0 19.4% 0.0% 0.0% 0.0% 180.43sec 23983 299.05sec
Necrolord_Emeni Necrolord_Emeni_infernal immolation 20153 202560 3376 117.00 1450 2900 39.0 117.0 19.4% 0.0% 0.0% 0.0% 5.49sec 202560 60.00sec
Necrolord_Emeni Necrolord_Emeni_infernal melee 0 16506 275 41.00 338 677 41.0 41.0 19.1% 0.0% 0.0% 0.0% 5.25sec 23577 60.00sec
Necrolord_Emeni Necrolord_Emeni_imp firebolt 3110 156896 525 18.52 1426 2853 93.0 92.3 19.2% 0.0% 0.0% 0.0% 3.22sec 156896 299.05sec
Necrolord_Marileth Necrolord_Marileth cataclysm 152108 231319 774 5.81 6697 13398 9.6 28.9 19.4% 0.0% 0.0% 0.0% 32.59sec 231319 299.05sec
Necrolord_Marileth Necrolord_Marileth channel_demonfire 196447 0 0 0.00 0 0 12.1 0.0 0.0% 0.0% 0.0% 0.0% 26.14sec 0 299.05sec
Necrolord_Marileth Necrolord_Marileth channel_demonfire_tick 196448 303928 1016 108.43 471 942 0.0 540.5 19.3% 0.0% 0.0% 0.0% 0.00sec 303928 299.05sec
Necrolord_Marileth Necrolord_Marileth chaos_bolt 116858 403619 1350 8.97 0 9030 22.5 44.7 100.0% 0.0% 0.0% 0.0% 13.06sec 403619 299.05sec
Necrolord_Marileth Necrolord_Marileth internal_combustion 266134 139029 465 8.88 2633 5272 44.3 44.3 19.3% 0.0% 0.0% 0.0% 13.03sec 139029 299.05sec
Necrolord_Marileth Necrolord_Marileth conflagrate 17962 244045 816 11.40 3609 7205 36.8 56.8 19.1% 0.0% 0.0% 0.0% 7.96sec 244045 299.05sec
Necrolord_Marileth Necrolord_Marileth decimating_bolt 325289 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 60.43sec 0 299.05sec
Necrolord_Marileth Necrolord_Marileth decimating_bolt_tick_t 327059 30170 101 4.03 1260 2519 0.0 20.1 19.4% 0.0% 0.0% 0.0% 0.00sec 30170 299.05sec
Necrolord_Marileth Necrolord_Marileth havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.38sec 0 299.05sec
Necrolord_Marileth Necrolord_Marileth immolate 348 63573 213 6.94 1536 3082 27.0 34.6 19.6% 0.0% 0.0% 0.0% 10.82sec 480880 299.05sec
Necrolord_Marileth Necrolord_Marileth immolate ticks -348 417307 1391 69.03 1014 2028 27.0 345.2 19.2% 0.0% 0.0% 0.0% 10.82sec 480880 299.05sec
Necrolord_Marileth Necrolord_Marileth incinerate 29722 242791 812 10.07 4068 8086 40.7 50.2 19.3% 0.0% 0.0% 0.0% 6.58sec 242791 299.05sec
Necrolord_Marileth Necrolord_Marileth rain_of_fire ticks -5740 258079 860 0.00 553 1107 16.5 0.0 19.3% 0.0% 0.0% 0.0% 17.26sec 258079 299.05sec
Necrolord_Marileth Necrolord_Marileth soul_fire 6353 152054 508 1.49 17064 33967 5.5 7.4 19.8% 0.0% 0.0% 0.0% 49.30sec 152054 299.05sec
Necrolord_Marileth Necrolord_Marileth summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.05sec
Necrolord_Marileth Necrolord_Marileth summon_infernal 1122 24149 81 1.20 3348 6696 2.0 6.0 20.2% 0.0% 0.0% 0.0% 180.58sec 24149 299.05sec
Necrolord_Marileth Necrolord_Marileth_infernal immolation 20153 213750 3562 117.00 1529 3058 39.0 117.0 19.5% 0.0% 0.0% 0.0% 5.49sec 213750 60.00sec
Necrolord_Marileth Necrolord_Marileth_infernal melee 0 15893 265 41.00 326 651 41.0 41.0 19.1% 0.0% 0.0% 0.0% 5.25sec 22702 60.00sec
Necrolord_Marileth Necrolord_Marileth_imp firebolt 3110 153762 514 18.52 1395 2790 93.0 92.3 19.4% 0.0% 0.0% 0.0% 3.22sec 153762 299.05sec
NightFae_Dream NightFae_Dream cataclysm 152108 232326 777 5.82 6700 13406 9.7 29.0 19.5% 0.0% 0.0% 0.0% 32.34sec 232326 299.05sec
NightFae_Dream NightFae_Dream channel_demonfire 196447 0 0 0.00 0 0 12.0 0.0 0.0% 0.0% 0.0% 0.0% 25.53sec 0 299.05sec
NightFae_Dream NightFae_Dream channel_demonfire_tick 196448 306000 1023 108.01 476 953 0.0 538.4 19.4% 0.0% 0.0% 0.0% 0.00sec 306000 299.05sec
NightFae_Dream NightFae_Dream chaos_bolt 116858 388700 1300 8.63 0 9035 21.6 43.0 100.0% 0.0% 0.0% 0.0% 13.61sec 388700 299.05sec
NightFae_Dream NightFae_Dream internal_combustion 266134 133629 447 8.56 2624 5245 42.7 42.7 19.3% 0.0% 0.0% 0.0% 13.64sec 133629 299.05sec
NightFae_Dream NightFae_Dream conflagrate 17962 241658 808 11.34 3583 7171 36.8 56.5 19.3% 0.0% 0.0% 0.0% 7.96sec 241658 299.05sec
NightFae_Dream NightFae_Dream havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.06sec 0 299.05sec
NightFae_Dream NightFae_Dream immolate 348 61229 205 6.77 1527 3063 26.5 33.7 18.8% 0.0% 0.0% 0.0% 11.05sec 480346 299.05sec
NightFae_Dream NightFae_Dream immolate ticks -348 419117 1397 69.24 1014 2028 26.5 346.2 19.4% 0.0% 0.0% 0.0% 11.05sec 480346 299.05sec
NightFae_Dream NightFae_Dream incinerate 29722 183763 614 11.08 2792 5600 44.6 55.2 19.1% 0.0% 0.0% 0.0% 6.08sec 183763 299.05sec
NightFae_Dream NightFae_Dream rain_of_fire ticks -5740 272498 908 0.00 553 1106 17.4 0.0 19.3% 0.0% 0.0% 0.0% 16.18sec 272498 299.05sec
NightFae_Dream NightFae_Dream soul_fire 6353 151686 507 1.57 16451 32535 5.5 7.8 18.3% 0.0% 0.0% 0.0% 49.40sec 151686 299.05sec
NightFae_Dream NightFae_Dream soul_rot ticks -325640 101655 339 19.31 882 1770 5.3 96.5 19.2% 0.0% 0.0% 0.0% 62.49sec 101655 299.05sec
NightFae_Dream NightFae_Dream summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.05sec
NightFae_Dream NightFae_Dream summon_infernal 1122 23903 80 1.20 3348 6696 2.0 6.0 19.0% 0.0% 0.0% 0.0% 180.75sec 23903 299.05sec
NightFae_Dream NightFae_Dream_infernal immolation 20153 213327 3555 117.00 1529 3057 39.0 117.0 19.2% 0.0% 0.0% 0.0% 5.50sec 213327 60.00sec
NightFae_Dream NightFae_Dream_infernal melee 0 15927 265 41.00 326 651 41.0 41.0 19.3% 0.0% 0.0% 0.0% 5.26sec 22749 60.00sec
NightFae_Dream NightFae_Dream_imp firebolt 3110 153148 512 18.52 1395 2790 93.0 92.3 18.9% 0.0% 0.0% 0.0% 3.22sec 153148 299.05sec
NightFae_Dream_SB NightFae_Dream_SB cataclysm 152108 235266 787 5.83 6807 13613 9.7 29.0 19.0% 0.0% 0.0% 0.0% 32.34sec 235266 299.05sec
NightFae_Dream_SB NightFae_Dream_SB channel_demonfire 196447 0 0 0.00 0 0 12.0 0.0 0.0% 0.0% 0.0% 0.0% 25.70sec 0 299.05sec
NightFae_Dream_SB NightFae_Dream_SB channel_demonfire_tick 196448 309864 1036 107.78 483 968 0.0 537.2 19.3% 0.0% 0.0% 0.0% 0.00sec 309864 299.05sec
NightFae_Dream_SB NightFae_Dream_SB chaos_bolt 116858 393071 1314 8.60 0 9169 21.5 42.9 100.0% 0.0% 0.0% 0.0% 13.66sec 393071 299.05sec
NightFae_Dream_SB NightFae_Dream_SB internal_combustion 266134 136383 456 8.53 2683 5367 42.5 42.5 19.5% 0.0% 0.0% 0.0% 13.65sec 136383 299.05sec
NightFae_Dream_SB NightFae_Dream_SB conflagrate 17962 244331 817 11.34 3636 7264 36.8 56.5 18.9% 0.0% 0.0% 0.0% 7.96sec 244331 299.05sec
NightFae_Dream_SB NightFae_Dream_SB havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.05sec 0 299.05sec
NightFae_Dream_SB NightFae_Dream_SB immolate 348 62553 209 6.77 1551 3102 26.6 33.7 19.6% 0.0% 0.0% 0.0% 10.99sec 487014 299.05sec
NightFae_Dream_SB NightFae_Dream_SB immolate ticks -348 424461 1415 69.26 1027 2053 26.6 346.3 19.3% 0.0% 0.0% 0.0% 10.99sec 487014 299.05sec
NightFae_Dream_SB NightFae_Dream_SB incinerate 29722 186922 625 11.10 2831 5661 44.7 55.3 19.4% 0.0% 0.0% 0.0% 6.03sec 186922 299.05sec
NightFae_Dream_SB NightFae_Dream_SB rain_of_fire ticks -5740 277934 926 0.00 560 1121 17.5 0.0 19.3% 0.0% 0.0% 0.0% 16.09sec 277934 299.05sec
NightFae_Dream_SB NightFae_Dream_SB soul_fire 6353 154868 518 1.57 16476 33107 5.5 7.8 20.0% 0.0% 0.0% 0.0% 49.47sec 154868 299.05sec
NightFae_Dream_SB NightFae_Dream_SB soul_rot ticks -325640 102934 343 19.32 895 1786 5.3 96.6 19.2% 0.0% 0.0% 0.0% 62.55sec 102934 299.05sec
NightFae_Dream_SB NightFae_Dream_SB summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.05sec
NightFae_Dream_SB NightFae_Dream_SB summon_infernal 1122 24096 81 1.20 3378 6754 2.0 6.0 18.9% 0.0% 0.0% 0.0% 180.49sec 24096 299.05sec
NightFae_Dream_SB NightFae_Dream_SB_infernal immolation 20153 197648 3294 117.00 1414 2828 39.0 117.0 19.5% 0.0% 0.0% 0.0% 5.49sec 197648 60.00sec
NightFae_Dream_SB NightFae_Dream_SB_infernal melee 0 16133 269 41.00 330 660 41.0 41.0 19.3% 0.0% 0.0% 0.0% 5.25sec 23044 60.00sec
NightFae_Dream_SB NightFae_Dream_SB_imp firebolt 3110 156401 523 18.52 1414 2828 93.0 92.3 19.8% 0.0% 0.0% 0.0% 3.22sec 156401 299.05sec
NightFae_Koraylon NightFae_Koraylon cataclysm 152108 238672 798 5.83 6893 13795 9.7 29.1 19.1% 0.0% 0.0% 0.0% 32.36sec 238672 299.05sec
NightFae_Koraylon NightFae_Koraylon channel_demonfire 196447 0 0 0.00 0 0 12.0 0.0 0.0% 0.0% 0.0% 0.0% 25.60sec 0 299.05sec
NightFae_Koraylon NightFae_Koraylon channel_demonfire_tick 196448 316163 1057 107.95 492 985 0.0 538.0 19.3% 0.0% 0.0% 0.0% 0.00sec 316163 299.05sec
NightFae_Koraylon NightFae_Koraylon chaos_bolt 116858 402272 1345 8.66 0 9319 21.7 43.2 100.0% 0.0% 0.0% 0.0% 13.37sec 402272 299.05sec
NightFae_Koraylon NightFae_Koraylon internal_combustion 266134 143219 479 8.59 2813 5626 42.8 42.8 19.0% 0.0% 0.0% 0.0% 13.44sec 143219 299.05sec
NightFae_Koraylon NightFae_Koraylon conflagrate 17962 248326 830 11.32 3699 7375 36.8 56.4 19.1% 0.0% 0.0% 0.0% 7.96sec 248326 299.05sec
NightFae_Koraylon NightFae_Koraylon havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.06sec 0 299.05sec
NightFae_Koraylon NightFae_Koraylon immolate 348 63244 211 6.77 1568 3130 26.5 33.7 19.6% 0.0% 0.0% 0.0% 10.93sec 492714 299.05sec
NightFae_Koraylon NightFae_Koraylon immolate ticks -348 429470 1432 69.25 1041 2081 26.5 346.3 19.1% 0.0% 0.0% 0.0% 10.93sec 492714 299.05sec
NightFae_Koraylon NightFae_Koraylon incinerate 29722 187824 628 11.04 2854 5736 44.6 55.0 19.4% 0.0% 0.0% 0.0% 6.15sec 187824 299.05sec
NightFae_Koraylon NightFae_Koraylon rain_of_fire ticks -5740 280590 935 0.00 570 1140 17.4 0.0 19.2% 0.0% 0.0% 0.0% 16.42sec 280590 299.05sec
NightFae_Koraylon NightFae_Koraylon soul_fire 6353 158989 532 1.57 16987 33435 5.5 7.8 20.2% 0.0% 0.0% 0.0% 49.33sec 158989 299.05sec
NightFae_Koraylon NightFae_Koraylon soul_rot ticks -325640 105501 352 19.30 914 1831 5.3 96.5 19.5% 0.0% 0.0% 0.0% 62.37sec 105501 299.05sec
NightFae_Koraylon NightFae_Koraylon summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.05sec
NightFae_Koraylon NightFae_Koraylon summon_infernal 1122 24948 83 1.20 3517 7021 2.0 6.0 18.3% 0.0% 0.0% 0.0% 180.66sec 24948 299.05sec
NightFae_Koraylon NightFae_Koraylon_infernal immolation 20153 194732 3245 117.00 1395 2790 39.0 117.0 19.3% 0.0% 0.0% 0.0% 5.50sec 194732 60.00sec
NightFae_Koraylon NightFae_Koraylon_infernal melee 0 15912 265 41.00 326 651 41.0 41.0 19.2% 0.0% 0.0% 0.0% 5.25sec 22729 60.00sec
NightFae_Koraylon NightFae_Koraylon_imp firebolt 3110 153662 514 18.52 1395 2790 93.0 92.3 19.3% 0.0% 0.0% 0.0% 3.22sec 153662 299.05sec
NightFae_Niya NightFae_Niya cataclysm 152108 238648 798 5.82 6886 13801 9.7 29.0 19.3% 0.0% 0.0% 0.0% 32.37sec 238648 299.05sec
NightFae_Niya NightFae_Niya channel_demonfire 196447 0 0 0.00 0 0 12.0 0.0 0.0% 0.0% 0.0% 0.0% 25.83sec 0 299.05sec
NightFae_Niya NightFae_Niya channel_demonfire_tick 196448 317810 1063 107.72 496 992 0.0 536.9 19.3% 0.0% 0.0% 0.0% 0.00sec 317810 299.05sec
NightFae_Niya NightFae_Niya chaos_bolt 116858 406260 1358 8.64 0 9438 21.6 43.0 100.0% 0.0% 0.0% 0.0% 13.27sec 406260 299.05sec
NightFae_Niya NightFae_Niya internal_combustion 266134 140300 469 8.57 2750 5475 42.7 42.7 19.7% 0.0% 0.0% 0.0% 13.28sec 140300 299.05sec
NightFae_Niya NightFae_Niya conflagrate 17962 252063 843 11.32 3738 7514 36.8 56.4 19.3% 0.0% 0.0% 0.0% 7.96sec 252063 299.05sec
NightFae_Niya NightFae_Niya havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.06sec 0 299.05sec
NightFae_Niya NightFae_Niya immolate 348 64594 216 6.80 1595 3191 26.7 33.9 19.6% 0.0% 0.0% 0.0% 10.70sec 501289 299.05sec
NightFae_Niya NightFae_Niya immolate ticks -348 436695 1456 69.27 1056 2112 26.7 346.3 19.4% 0.0% 0.0% 0.0% 10.70sec 501289 299.05sec
NightFae_Niya NightFae_Niya incinerate 29722 190821 638 11.02 2907 5792 44.5 54.9 19.7% 0.0% 0.0% 0.0% 6.23sec 190821 299.05sec
NightFae_Niya NightFae_Niya rain_of_fire ticks -5740 283941 946 0.00 576 1153 17.4 0.0 19.3% 0.0% 0.0% 0.0% 16.67sec 283941 299.05sec
NightFae_Niya NightFae_Niya soul_fire 6353 158628 530 1.57 16814 33893 5.5 7.8 20.4% 0.0% 0.0% 0.0% 49.31sec 158628 299.05sec
NightFae_Niya NightFae_Niya soul_rot ticks -325640 101717 339 19.33 884 1757 5.3 96.6 19.3% 0.0% 0.0% 0.0% 62.37sec 101717 299.05sec
NightFae_Niya NightFae_Niya summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.05sec
NightFae_Niya NightFae_Niya summon_infernal 1122 23844 80 1.20 3348 6696 2.0 6.0 18.7% 0.0% 0.0% 0.0% 180.57sec 23844 299.05sec
NightFae_Niya NightFae_Niya_infernal immolation 20153 194790 3246 117.00 1395 2790 39.0 117.0 19.3% 0.0% 0.0% 0.0% 5.49sec 194790 60.00sec
NightFae_Niya NightFae_Niya_infernal melee 0 15885 265 41.00 326 651 41.0 41.0 19.0% 0.0% 0.0% 0.0% 5.25sec 22690 60.00sec
NightFae_Niya NightFae_Niya_imp firebolt 3110 153487 513 18.52 1395 2790 93.0 92.3 19.2% 0.0% 0.0% 0.0% 3.22sec 153487 299.05sec
Venthyr_Nadjia Venthyr_Nadjia cataclysm 152108 232743 778 5.83 6700 13386 9.7 29.1 19.5% 0.0% 0.0% 0.0% 32.36sec 232743 299.05sec
Venthyr_Nadjia Venthyr_Nadjia channel_demonfire 196447 0 0 0.00 0 0 12.8 0.0 0.0% 0.0% 0.0% 0.0% 24.13sec 0 299.05sec
Venthyr_Nadjia Venthyr_Nadjia channel_demonfire_tick 196448 322930 1080 115.44 471 940 0.0 575.4 19.3% 0.0% 0.0% 0.0% 0.00sec 322930 299.05sec
Venthyr_Nadjia Venthyr_Nadjia chaos_bolt 116858 408529 1366 9.07 0 9034 22.7 45.2 100.0% 0.0% 0.0% 0.0% 12.96sec 408529 299.05sec
Venthyr_Nadjia Venthyr_Nadjia internal_combustion 266134 143867 481 8.98 2691 5388 44.7 44.7 19.4% 0.0% 0.0% 0.0% 12.98sec 143867 299.05sec
Venthyr_Nadjia Venthyr_Nadjia conflagrate 17962 245756 822 11.36 3638 7284 37.8 56.6 19.3% 0.0% 0.0% 0.0% 7.78sec 245756 299.05sec
Venthyr_Nadjia Venthyr_Nadjia havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.32sec 0 299.05sec
Venthyr_Nadjia Venthyr_Nadjia immolate 348 65126 218 7.12 1541 3067 28.2 35.5 19.3% 0.0% 0.0% 0.0% 10.50sec 493903 299.05sec
Venthyr_Nadjia Venthyr_Nadjia immolate ticks -348 428777 1429 70.97 1012 2024 28.2 354.9 19.4% 0.0% 0.0% 0.0% 10.50sec 493903 299.05sec
Venthyr_Nadjia Venthyr_Nadjia impending_catastrophe 321792 0 0 0.00 0 0 4.6 0.0 0.0% 0.0% 0.0% 0.0% 64.74sec 0 299.05sec
Venthyr_Nadjia Venthyr_Nadjia impending_catastrophe_impact 322167 9222 31 2.78 558 1116 0.0 13.8 19.4% 0.0% 0.0% 0.0% 0.00sec 9222 299.05sec
Venthyr_Nadjia Venthyr_Nadjia impending_catastrophe_dot ticks -322170 60188 201 21.23 476 951 0.0 106.1 19.3% 0.0% 0.0% 0.0% 0.00sec 60188 299.05sec
Venthyr_Nadjia Venthyr_Nadjia incinerate 29722 179170 599 10.86 2773 5551 43.1 54.1 19.3% 0.0% 0.0% 0.0% 6.20sec 179170 299.05sec
Venthyr_Nadjia Venthyr_Nadjia rain_of_fire ticks -5740 265770 886 0.00 553 1105 17.0 0.0 19.3% 0.0% 0.0% 0.0% 16.75sec 265770 299.05sec
Venthyr_Nadjia Venthyr_Nadjia soul_fire 6353 153426 513 1.52 16896 33687 5.5 7.6 20.0% 0.0% 0.0% 0.0% 49.65sec 153426 299.05sec
Venthyr_Nadjia Venthyr_Nadjia summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.05sec
Venthyr_Nadjia Venthyr_Nadjia summon_infernal 1122 23791 80 1.20 3348 6696 2.0 6.0 18.4% 0.0% 0.0% 0.0% 180.92sec 23791 299.05sec
Venthyr_Nadjia Venthyr_Nadjia_infernal immolation 20153 194661 3244 117.00 1395 2790 39.0 117.0 19.3% 0.0% 0.0% 0.0% 5.50sec 194661 60.00sec
Venthyr_Nadjia Venthyr_Nadjia_infernal melee 0 15958 266 41.00 326 651 41.0 41.0 19.6% 0.0% 0.0% 0.0% 5.26sec 22794 60.00sec
Venthyr_Nadjia Venthyr_Nadjia_imp firebolt 3110 156650 524 18.90 1395 2790 94.9 94.2 19.2% 0.0% 0.0% 0.0% 3.15sec 156650 299.05sec
Venthyr_Theotar Venthyr_Theotar cataclysm 152108 238191 796 5.81 6888 13777 9.7 29.0 19.4% 0.0% 0.0% 0.0% 32.41sec 238191 299.05sec
Venthyr_Theotar Venthyr_Theotar channel_demonfire 196447 0 0 0.00 0 0 12.2 0.0 0.0% 0.0% 0.0% 0.0% 25.39sec 0 299.05sec
Venthyr_Theotar Venthyr_Theotar channel_demonfire_tick 196448 315943 1056 109.85 483 969 0.0 547.5 19.3% 0.0% 0.0% 0.0% 0.00sec 315943 299.05sec
Venthyr_Theotar Venthyr_Theotar chaos_bolt 116858 416910 1394 9.01 0 9280 22.6 44.9 100.0% 0.0% 0.0% 0.0% 13.12sec 416910 299.05sec
Venthyr_Theotar Venthyr_Theotar internal_combustion 266134 143376 479 8.94 2703 5395 44.5 44.5 19.2% 0.0% 0.0% 0.0% 13.13sec 143376 299.05sec
Venthyr_Theotar Venthyr_Theotar conflagrate 17962 245741 822 11.14 3720 7440 37.0 55.5 18.9% 0.0% 0.0% 0.0% 7.95sec 245741 299.05sec
Venthyr_Theotar Venthyr_Theotar havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.24sec 0 299.05sec
Venthyr_Theotar Venthyr_Theotar immolate 348 66010 221 7.02 1580 3152 28.0 35.0 19.5% 0.0% 0.0% 0.0% 10.36sec 494058 299.05sec
Venthyr_Theotar Venthyr_Theotar immolate ticks -348 428048 1427 68.99 1041 2082 28.0 344.9 19.2% 0.0% 0.0% 0.0% 10.36sec 494058 299.05sec
Venthyr_Theotar Venthyr_Theotar impending_catastrophe 321792 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 64.66sec 0 299.05sec
Venthyr_Theotar Venthyr_Theotar impending_catastrophe_impact 322167 9252 31 2.79 558 1116 0.0 13.9 19.4% 0.0% 0.0% 0.0% 0.00sec 9252 299.05sec
Venthyr_Theotar Venthyr_Theotar impending_catastrophe_dot ticks -322170 58771 196 20.35 484 967 0.0 101.8 19.4% 0.0% 0.0% 0.0% 0.00sec 58771 299.05sec
Venthyr_Theotar Venthyr_Theotar incinerate 29722 177598 594 10.49 2844 5721 41.6 52.3 19.3% 0.0% 0.0% 0.0% 6.48sec 177598 299.05sec
Venthyr_Theotar Venthyr_Theotar rain_of_fire ticks -5740 261202 871 0.00 568 1136 16.3 0.0 19.2% 0.0% 0.0% 0.0% 17.32sec 261202 299.05sec
Venthyr_Theotar Venthyr_Theotar soul_fire 6353 153832 514 1.51 17097 34081 5.5 7.5 19.5% 0.0% 0.0% 0.0% 49.43sec 153832 299.05sec
Venthyr_Theotar Venthyr_Theotar summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.05sec
Venthyr_Theotar Venthyr_Theotar summon_infernal 1122 23699 79 1.20 3348 6696 2.0 6.0 18.0% 0.0% 0.0% 0.0% 180.51sec 23699 299.05sec
Venthyr_Theotar Venthyr_Theotar_infernal immolation 20153 194308 3238 117.00 1395 2790 39.0 117.0 19.0% 0.0% 0.0% 0.0% 5.49sec 194308 60.00sec
Venthyr_Theotar Venthyr_Theotar_infernal melee 0 15839 264 41.00 326 651 41.0 41.0 18.7% 0.0% 0.0% 0.0% 5.25sec 22624 60.00sec
Venthyr_Theotar Venthyr_Theotar_imp firebolt 3110 153351 513 18.52 1395 2790 93.0 92.3 19.1% 0.0% 0.0% 0.0% 3.22sec 153351 299.05sec
destruction destruction cataclysm 152108 231729 775 5.81 6706 13414 9.7 29.0 19.3% 0.0% 0.0% 0.0% 32.55sec 231729 299.05sec
destruction destruction channel_demonfire 196447 0 0 0.00 0 0 12.3 0.0 0.0% 0.0% 0.0% 0.0% 25.18sec 0 299.05sec
destruction destruction channel_demonfire_tick 196448 308054 1030 110.21 470 942 0.0 549.3 19.2% 0.0% 0.0% 0.0% 0.00sec 308054 299.05sec
destruction destruction chaos_bolt 116858 372964 1247 8.78 0 8524 22.0 43.8 100.0% 0.0% 0.0% 0.0% 13.28sec 372964 299.05sec
destruction destruction internal_combustion 266134 135845 454 8.67 2630 5247 43.2 43.2 19.6% 0.0% 0.0% 0.0% 13.21sec 135845 299.05sec
destruction destruction conflagrate 17962 240740 805 11.23 3602 7197 37.0 56.0 19.5% 0.0% 0.0% 0.0% 7.97sec 240740 299.05sec
destruction destruction havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.38sec 0 299.05sec
destruction destruction immolate 348 63908 214 7.00 1532 3088 27.9 34.9 19.4% 0.0% 0.0% 0.0% 10.33sec 482671 299.05sec
destruction destruction immolate ticks -348 418763 1396 69.13 1014 2027 27.9 345.7 19.5% 0.0% 0.0% 0.0% 10.33sec 482671 299.05sec
destruction destruction incinerate 29722 182636 611 11.66 2630 5277 46.8 58.1 19.4% 0.0% 0.0% 0.0% 5.89sec 182636 299.05sec
destruction destruction rain_of_fire ticks -5740 267672 892 0.00 553 1106 17.1 0.0 19.4% 0.0% 0.0% 0.0% 16.74sec 267672 299.05sec
destruction destruction soul_fire 6353 151573 507 1.51 16999 33678 5.5 7.5 18.7% 0.0% 0.0% 0.0% 49.52sec 151573 299.05sec
destruction destruction summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.05sec
destruction destruction summon_infernal 1122 24289 81 1.20 3348 6696 2.0 6.0 20.9% 0.0% 0.0% 0.0% 180.65sec 24289 299.05sec
destruction destruction_infernal immolation 20153 194317 3239 117.00 1395 2790 39.0 117.0 19.1% 0.0% 0.0% 0.0% 5.50sec 194317 60.00sec
destruction destruction_infernal melee 0 15900 265 41.00 326 651 41.0 41.0 19.1% 0.0% 0.0% 0.0% 5.25sec 22712 60.00sec
destruction destruction_imp firebolt 3110 153641 514 18.52 1395 2790 93.0 92.3 19.3% 0.0% 0.0% 0.0% 3.22sec 153641 299.05sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
53987.9 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 55.5sec 12.96% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 154.8s

Stack Uptimes

  • Health Decade (0 - 10)_1:13.07%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 28.3sec 8.55% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.2s / 42.5s

Stack Uptimes

  • Health Decade (10 - 20)_1:8.55%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 30.2sec 10.14% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:2.1s / 42.7s

Stack Uptimes

  • Health Decade (20 - 30)_1:10.14%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 29.9sec 10.11% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:24.3s / 39.7s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.11%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 33.4sec 11.31% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.8s / 39.2s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.31%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 34.1sec 11.54% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:24.6s / 41.6s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.54%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 33.8sec 11.46% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:24.7s / 42.1s

Stack Uptimes

  • Health Decade (60 - 70)_1:11.46%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 30.9sec 10.47% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:20.0s / 43.1s

Stack Uptimes

  • Health Decade (70 - 80)_1:10.47%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 22.4sec 7.58% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.3s / 31.6s

Stack Uptimes

  • Health Decade (80 - 90)_1:7.58%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 24.4sec 5.88% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.8s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:5.88%
infernal: Infernal Brand 2.0 39.0 176.3sec 5.3sec 37.5sec 25.39% 0.00% 11.0 (11.0) 2.0

Buff Details

  • buff initial source:NightFae_Dream_infernal
  • cooldown name:buff_infernal_brand
  • max_stacks:15
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 184.9s
  • trigger_min/max:1.3s / 155.5s
  • trigger_pct:100.00%
  • duration_min/max:37.4s / 37.5s

Stack Uptimes

  • infernal_brand_1:1.04%
  • infernal_brand_2:1.04%
  • infernal_brand_3:1.04%
  • infernal_brand_4:1.04%
  • infernal_brand_5:1.04%
  • infernal_brand_6:1.04%
  • infernal_brand_7:1.04%
  • infernal_brand_8:1.04%
  • infernal_brand_9:1.04%
  • infernal_brand_10:1.04%
  • infernal_brand_11:1.04%
  • infernal_brand_12:1.04%
  • infernal_brand_13:1.04%
  • infernal_brand_14:1.04%
  • infernal_brand_15:10.81%

Spelldata

  • id:340045
  • name:Infernal Brand
  • tooltip:Taking $w1% increased Fire damage from Infernal.
  • description:{$@spelldesc340041=Your Infernal's melee attacks cause its target to take |cFFFFFFFF${$s1}.1%|r increased damage from its Immolation, stacking up to {$340045u=15} times.}
  • max_stacks:15
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
infernal: Infernal Brand 2.0 39.0 176.2sec 5.3sec 37.5sec 25.39% 0.00% 11.0 (11.0) 2.0

Buff Details

  • buff initial source:Kyrian_Pelagos_infernal
  • cooldown name:buff_infernal_brand
  • max_stacks:15
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.9s / 185.9s
  • trigger_min/max:1.3s / 156.6s
  • trigger_pct:100.00%
  • duration_min/max:37.4s / 37.5s

Stack Uptimes

  • infernal_brand_1:1.04%
  • infernal_brand_2:1.04%
  • infernal_brand_3:1.04%
  • infernal_brand_4:1.04%
  • infernal_brand_5:1.04%
  • infernal_brand_6:1.04%
  • infernal_brand_7:1.04%
  • infernal_brand_8:1.04%
  • infernal_brand_9:1.04%
  • infernal_brand_10:1.04%
  • infernal_brand_11:1.04%
  • infernal_brand_12:1.04%
  • infernal_brand_13:1.04%
  • infernal_brand_14:1.04%
  • infernal_brand_15:10.81%

Spelldata

  • id:340045
  • name:Infernal Brand
  • tooltip:Taking $w1% increased Fire damage from Infernal.
  • description:{$@spelldesc340041=Your Infernal's melee attacks cause its target to take |cFFFFFFFF${$s1}.1%|r increased damage from its Immolation, stacking up to {$340045u=15} times.}
  • max_stacks:15
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
infernal: Infernal Brand 2.0 39.0 176.4sec 5.3sec 37.5sec 25.39% 0.00% 11.0 (11.0) 2.0

Buff Details

  • buff initial source:Necrolord_Marileth_infernal
  • cooldown name:buff_infernal_brand
  • max_stacks:15
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.9s / 183.1s
  • trigger_min/max:1.3s / 153.7s
  • trigger_pct:100.00%
  • duration_min/max:37.4s / 37.5s

Stack Uptimes

  • infernal_brand_1:1.04%
  • infernal_brand_2:1.04%
  • infernal_brand_3:1.04%
  • infernal_brand_4:1.04%
  • infernal_brand_5:1.04%
  • infernal_brand_6:1.04%
  • infernal_brand_7:1.04%
  • infernal_brand_8:1.04%
  • infernal_brand_9:1.04%
  • infernal_brand_10:1.04%
  • infernal_brand_11:1.04%
  • infernal_brand_12:1.04%
  • infernal_brand_13:1.04%
  • infernal_brand_14:1.04%
  • infernal_brand_15:10.81%

Spelldata

  • id:340045
  • name:Infernal Brand
  • tooltip:Taking $w1% increased Fire damage from Infernal.
  • description:{$@spelldesc340041=Your Infernal's melee attacks cause its target to take |cFFFFFFFF${$s1}.1%|r increased damage from its Immolation, stacking up to {$340045u=15} times.}
  • max_stacks:15
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Conflagrate (roaring_blaze) 19.1 17.8 15.5sec 7.9sec 12.5sec 80.20% 0.00% 17.8 (17.8) 18.3

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 40.2s
  • trigger_min/max:2.1s / 24.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.1s

Stack Uptimes

  • roaring_blaze_1:80.20%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 19.2 17.6 15.4sec 7.9sec 12.4sec 79.46% 0.00% 17.6 (17.6) 18.4

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 48.5s
  • trigger_min/max:2.1s / 24.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 46.3s

Stack Uptimes

  • roaring_blaze_1:79.46%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 19.3 17.5 15.4sec 8.0sec 12.3sec 79.51% 0.00% 17.5 (17.5) 18.5

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 47.8s
  • trigger_min/max:2.1s / 24.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 40.8s

Stack Uptimes

  • roaring_blaze_1:79.51%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 19.2 17.6 15.4sec 8.0sec 12.3sec 79.39% 0.00% 17.6 (17.6) 18.4

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 46.7s
  • trigger_min/max:2.1s / 24.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.1s

Stack Uptimes

  • roaring_blaze_1:79.39%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 19.2 17.5 15.4sec 8.0sec 12.4sec 79.48% 0.00% 17.5 (17.5) 18.5

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 49.5s
  • trigger_min/max:2.1s / 24.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.1s

Stack Uptimes

  • roaring_blaze_1:79.48%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.6 18.4 16.0sec 7.9sec 12.9sec 80.01% 0.00% 18.4 (18.4) 17.8

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 52.8s
  • trigger_min/max:1.9s / 23.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.4s

Stack Uptimes

  • roaring_blaze_1:80.01%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 17.7 20.1 16.9sec 7.8sec 13.8sec 81.27% 0.00% 20.1 (20.1) 16.8

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 41.1s
  • trigger_min/max:1.9s / 22.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 39.0s

Stack Uptimes

  • roaring_blaze_1:81.27%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.1 18.7 16.4sec 8.0sec 13.0sec 78.36% 0.00% 18.7 (18.7) 17.3

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 50.4s
  • trigger_min/max:1.9s / 23.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.6s

Stack Uptimes

  • roaring_blaze_1:78.36%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.1 18.7 16.4sec 8.0sec 13.0sec 78.37% 0.00% 18.7 (18.7) 17.3

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 49.0s
  • trigger_min/max:1.9s / 23.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.5s

Stack Uptimes

  • roaring_blaze_1:78.37%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 17.9 19.0 16.6sec 8.0sec 13.1sec 78.20% 0.00% 19.0 (19.0) 17.1

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 50.0s
  • trigger_min/max:1.9s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 41.7s

Stack Uptimes

  • roaring_blaze_1:78.20%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.8 17.9 15.8sec 8.0sec 12.5sec 78.29% 0.00% 17.9 (17.9) 18.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 46.6s
  • trigger_min/max:1.9s / 23.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 38.5s

Stack Uptimes

  • roaring_blaze_1:78.29%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 625
Mean 299.05
Minimum 240.24
Maximum 359.94
Spread ( max - min ) 119.70
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
Fluffy_Pillow Damage Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 625
Mean 57645.77
Minimum 55659.33
Maximum 60266.80
Spread ( max - min ) 4607.47
Range [ ( max - min ) / 2 * 100% ] 4.00%
Standard Deviation 942.3651
5th Percentile 56377.17
95th Percentile 59231.18
( 95th Percentile - 5th Percentile ) 2854.01
Mean Distribution
Standard Deviation 37.6946
95.00% Confidence Interval ( 57571.89 - 57719.65 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1027
0.1 Scale Factor Error with Delta=300 7581
0.05 Scale Factor Error with Delta=300 30324
0.01 Scale Factor Error with Delta=300 758093
HPS
Fluffy_Pillow Healing Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 43
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 16874988 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
28503.1 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.8 0.0 0.0sec 0.0sec 57.6sec 13.58% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 147.7s

Stack Uptimes

  • Health Decade (0 - 10)_1:13.71%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 28.8sec 8.90% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.9s / 47.1s

Stack Uptimes

  • Health Decade (10 - 20)_1:8.91%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 29.8sec 10.01% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:5.3s / 50.5s

Stack Uptimes

  • Health Decade (20 - 30)_1:10.01%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 29.8sec 10.11% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:22.5s / 36.6s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.11%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 34.5sec 11.69% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:24.3s / 42.1s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.69%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 36.7sec 12.43% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.8s / 50.2s

Stack Uptimes

  • Health Decade (50 - 60)_1:12.43%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 34.6sec 11.72% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.1s / 48.4s

Stack Uptimes

  • Health Decade (60 - 70)_1:11.72%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 28.9sec 9.78% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:19.0s / 40.4s

Stack Uptimes

  • Health Decade (70 - 80)_1:9.78%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 18.3sec 6.21% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:10.3s / 27.0s

Stack Uptimes

  • Health Decade (80 - 90)_1:6.21%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 23.5sec 5.56% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.4s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:5.56%
Havoc 9.6 0.0 32.3sec 32.4sec 11.8sec 37.78% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.5s
  • trigger_min/max:30.0s / 39.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.78%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.0sec 32.0sec 11.8sec 38.01% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.9s / 40.1s
  • trigger_min/max:30.0s / 40.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:38.01%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 31.9sec 32.0sec 11.8sec 38.03% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.9s / 40.1s
  • trigger_min/max:30.0s / 40.1s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 12.0s

Stack Uptimes

  • havoc_1:38.03%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.0sec 32.0sec 11.8sec 38.01% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.9s / 39.5s
  • trigger_min/max:30.0s / 39.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:38.01%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.0sec 32.0sec 11.8sec 38.01% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.9s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:38.01%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.2sec 32.3sec 11.8sec 37.87% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.8s / 39.4s
  • trigger_min/max:30.0s / 39.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:37.87%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.2sec 32.3sec 11.8sec 37.86% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.5s
  • trigger_min/max:30.0s / 39.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.86%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.1sec 32.2sec 11.8sec 37.91% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:37.91%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.1sec 32.2sec 11.8sec 37.97% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.97%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.3sec 32.4sec 11.8sec 37.73% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.9s
  • trigger_min/max:30.0s / 39.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.73%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.1sec 32.2sec 11.8sec 37.90% 0.00% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.8s / 39.4s
  • trigger_min/max:30.0s / 39.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.90%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Conflagrate (roaring_blaze) 10.4 8.6 29.3sec 15.5sec 11.4sec 39.59% 0.00% 8.6 (8.6) 10.0

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 42.0s
  • trigger_min/max:2.4s / 40.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s

Stack Uptimes

  • roaring_blaze_1:39.59%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.5 9.1 28.7sec 14.9sec 11.7sec 41.21% 0.00% 9.1 (9.1) 10.2

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 42.0s
  • trigger_min/max:2.4s / 41.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s

Stack Uptimes

  • roaring_blaze_1:41.21%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.5 9.2 28.9sec 14.8sec 11.7sec 41.24% 0.00% 9.2 (9.2) 10.1

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 42.0s
  • trigger_min/max:2.4s / 40.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.2s

Stack Uptimes

  • roaring_blaze_1:41.24%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.5 9.2 28.7sec 14.8sec 11.7sec 41.31% 0.00% 9.2 (9.2) 10.2

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 41.9s
  • trigger_min/max:2.4s / 41.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.7s

Stack Uptimes

  • roaring_blaze_1:41.31%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.5 9.1 28.7sec 14.9sec 11.7sec 41.22% 0.00% 9.1 (9.1) 10.2

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 42.2s
  • trigger_min/max:2.4s / 41.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s

Stack Uptimes

  • roaring_blaze_1:41.22%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.2 8.3 29.7sec 15.8sec 11.3sec 38.80% 0.00% 8.3 (8.3) 9.9

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 42.1s
  • trigger_min/max:2.4s / 41.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.2s

Stack Uptimes

  • roaring_blaze_1:38.80%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.7 8.2 28.5sec 15.6sec 11.1sec 39.59% 0.00% 8.2 (8.2) 10.3

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 58.9s
  • trigger_min/max:2.4s / 51.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.7s

Stack Uptimes

  • roaring_blaze_1:39.59%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 11.1 6.9 27.0sec 16.2sec 10.7sec 39.85% 0.00% 6.9 (6.9) 10.8

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 69.5s
  • trigger_min/max:2.4s / 69.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s

Stack Uptimes

  • roaring_blaze_1:39.85%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 11.1 6.8 27.0sec 16.3sec 10.6sec 39.63% 0.00% 6.8 (6.8) 10.7

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.1s / 57.0s
  • trigger_min/max:2.4s / 57.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s

Stack Uptimes

  • roaring_blaze_1:39.63%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.2 9.8 30.0sec 14.6sec 12.2sec 41.31% 0.00% 9.8 (9.8) 9.8

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 42.1s
  • trigger_min/max:2.4s / 40.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.4s

Stack Uptimes

  • roaring_blaze_1:41.31%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 12.0 6.4 24.9sec 15.9sec 10.4sec 41.72% 0.00% 6.4 (6.4) 11.6

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 66.8s
  • trigger_min/max:2.4s / 66.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.3s

Stack Uptimes

  • roaring_blaze_1:41.72%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy2 Fight Length
Count 625
Mean 299.05
Minimum 240.24
Maximum 359.94
Spread ( max - min ) 119.70
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
enemy2 Damage Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy2 Priority Target Damage Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy2 Damage Per Second (Effective)
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy2 Damage
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy2 Damage Taken Per Second
Count 625
Mean 30518.55
Minimum 29135.23
Maximum 32272.33
Spread ( max - min ) 3137.10
Range [ ( max - min ) / 2 * 100% ] 5.14%
Standard Deviation 674.0063
5th Percentile 29629.60
95th Percentile 31734.76
( 95th Percentile - 5th Percentile ) 2105.15
Mean Distribution
Standard Deviation 26.9603
95.00% Confidence Interval ( 30465.71 - 30571.39 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1874
0.1 Scale Factor Error with Delta=300 3879
0.05 Scale Factor Error with Delta=300 15513
0.01 Scale Factor Error with Delta=300 387804
HPS
enemy2 Healing Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy2 Healing Per Second (Effective)
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy2 Heal
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy2 Healing Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy2 Theck-Meloree Index
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy2Theck-Meloree Index (Effective)
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy2 Max Spike Value
Count 43
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 9153161 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy2"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy3 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
17326.4 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 57.8sec 13.34% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 154.4s

Stack Uptimes

  • Health Decade (0 - 10)_1:13.45%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 29.4sec 8.84% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 49.1s

Stack Uptimes

  • Health Decade (10 - 20)_1:8.85%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 28.0sec 9.39% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:2.6s / 50.1s

Stack Uptimes

  • Health Decade (20 - 30)_1:9.39%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 27.6sec 9.37% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:17.6s / 42.3s

Stack Uptimes

  • Health Decade (30 - 40)_1:9.37%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 33.4sec 11.32% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.0s / 44.4s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.32%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 38.5sec 13.04% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:24.8s / 48.9s

Stack Uptimes

  • Health Decade (50 - 60)_1:13.04%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.6sec 12.76% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.5s / 48.5s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.76%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 31.2sec 10.59% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:10.1s / 48.0s

Stack Uptimes

  • Health Decade (70 - 80)_1:10.59%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 15.3sec 5.17% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.1s / 26.0s

Stack Uptimes

  • Health Decade (80 - 90)_1:5.17%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 25.2sec 6.17% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.3s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:6.17%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy3 Fight Length
Count 625
Mean 299.05
Minimum 240.24
Maximum 359.94
Spread ( max - min ) 119.70
Range [ ( max - min ) / 2 * 100% ] 20.01%
DPS
enemy3 Damage Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy3 Priority Target Damage Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy3 Damage Per Second (Effective)
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy3 Damage
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy3 Damage Taken Per Second
Count 625
Mean 18436.87
Minimum 17492.69
Maximum 19439.87
Spread ( max - min ) 1947.17
Range [ ( max - min ) / 2 * 100% ] 5.28%
Standard Deviation 439.2909
5th Percentile 17796.81
95th Percentile 19155.71
( 95th Percentile - 5th Percentile ) 1358.90
Mean Distribution
Standard Deviation 17.5716
95.00% Confidence Interval ( 18402.43 - 18471.31 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2181
0.1 Scale Factor Error with Delta=300 1648
0.05 Scale Factor Error with Delta=300 6590
0.01 Scale Factor Error with Delta=300 164736
HPS
enemy3 Healing Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy3 Healing Per Second (Effective)
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy3 Heal
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy3 Healing Taken Per Second
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy3 Theck-Meloree Index
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy3Theck-Meloree Index (Effective)
Count 625
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy3 Max Spike Value
Count 43
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 4803098 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy3"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.